AMPDB_3237 | Venom antimicrobial peptide-9

PEPTIDE SUMMARY

Venom antimicrobial peptide-9

1 General Description

AMPDB ID: AMPDB_3237

Protein Names: Venom antimicrobial peptide-9 (Meucin-18)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Medium-length antimicrobial peptide (group 3) family

Gene Name: Nil

Source Organism: Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus)

Protein Length: 69 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MVIFLAYFLVVNESEAFFGHLFKLATKIIPSLFQRKKERSVMNRDLENLFDPYQRNLEMDRLLKQLRNY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 6, 'N': 5, 'D': 3, 'C': 0, 'Q': 3, 'E': 5, 'G': 1, 'H': 1, 'I': 3, 'L': 11, 'K': 5, 'M': 3, 'F': 7, 'P': 2, 'S': 3, 'T': 1, 'W': 0, 'Y': 3, 'V': 4

Frequencies of Amino Acids

'A': 4.35%, 'R': 8.7%, 'N': 7.25%, 'D': 4.35%, 'C': 0%, 'Q': 4.35%, 'E': 7.25%, 'G': 1.45%, 'H': 1.45%, 'I': 4.35%, 'L': 15.94%, 'K': 7.25%, 'M': 4.35%, 'F': 10.14%, 'P': 2.9%, 'S': 4.35%, 'T': 1.45%, 'W': 0%, 'Y': 4.35%, 'V': 5.8%

Missing Amino Acid(s)

C, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

G, H, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8399.87 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	100.29	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.806	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.196	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.754	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.002	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.095	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.406, 0.159, 0.319 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.145	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Beauveria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Cytolytic, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Gao B, Sherman P, Luo L, et al. Structural and functional characterization of two genetically related meucin peptides highlights evolutionary divergence and convergence in antimicrobial peptides. FASEB J. 2009;23(4):1230-45. Published 2009 Apr. doi:10.1096/fj.08-122317

PMID: 19088182

5.2 Protein Sequence Databases

UniProt: E4VP50

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: E4VP50

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EF445092	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download