AMPDB_3225 | Esculentin-2CG1
PEPTIDE SUMMARY
Esculentin-2CG1
1 General Description
AMPDB ID: AMPDB_3225
Protein Names: Esculentin-2CG1
Protein Family: Frog skin active peptide (FSAP) family; Esculentin subfamily
Gene Name: Nil
Protein Length: 76 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MFTMKKSMLLLFFLGTISLSLCEEERSADEDDGEEEVKRSLFSIFKTAAKFVGKNLLKQAGKAGLETLACKAKNEC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 2, 'N': 2, 'D': 3, 'C': 3, 'Q': 1, 'E': 9, 'G': 5, 'H': 0, 'I': 2, 'L': 11, 'K': 10, 'M': 3, 'F': 6, 'P': 0, 'S': 6, 'T': 4, 'W': 0, 'Y': 0, 'V': 2
Frequencies of Amino Acids
'A': 9.21%, 'R': 2.63%, 'N': 2.63%, 'D': 3.95%, 'C': 3.95%, 'Q': 1.32%, 'E': 11.84%, 'G': 6.58%, 'H': 0%, 'I': 2.63%, 'L': 14.47%, 'K': 13.16%, 'M': 3.95%, 'F': 7.89%, 'P': 0%, 'S': 7.89%, 'T': 5.26%, 'W': 0%, 'Y': 0%, 'V': 2.63%
Missing Amino Acid(s)
H, P, W, Y
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
Q
Hydrophobic Amino Acid(s) Count
36
Hydrophilic Amino Acid(s) Count
40
Basic Amino Acid(s) Count
12
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8440.87 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 83.553 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 50.041 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.109 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.657 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.534 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -0.174 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.276, 0.171, 0.395 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.079 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 125 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Yang X, Xia J, Yu Z, et al. Characterization of diverse antimicrobial peptides in skin secretions of Chungan torrent frog Amolops chunganensis. Peptides. 2012;38(1):41-53. Published 2012 Nov. doi:10.1016/j.peptides.2012.08.008
PMID: 22951323
5.2 Protein Sequence Databases
UniProt: E1B230
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: E1B230
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. HQ128605 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012521, IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India