AMPDB_3223 | Brevinin-2MT1
PEPTIDE SUMMARY
Brevinin-2MT1
1 General Description
AMPDB ID: AMPDB_3223
Protein Names: Brevinin-2MT1
Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily
Gene Name: Nil
Protein Length: 74 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MFTMKKSLLVLFFLGTISLSLCEEERNADEDDGEMTEEEKRGLLSTFKQVGISALQGAAQGLLNTLSCKIAKTC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 5, 'R': 2, 'N': 2, 'D': 3, 'C': 3, 'Q': 3, 'E': 8, 'G': 6, 'H': 0, 'I': 3, 'L': 12, 'K': 6, 'M': 3, 'F': 4, 'P': 0, 'S': 6, 'T': 6, 'W': 0, 'Y': 0, 'V': 2
Frequencies of Amino Acids
'A': 6.76%, 'R': 2.7%, 'N': 2.7%, 'D': 4.05%, 'C': 4.05%, 'Q': 4.05%, 'E': 10.81%, 'G': 8.11%, 'H': 0%, 'I': 4.05%, 'L': 16.22%, 'K': 8.11%, 'M': 4.05%, 'F': 5.41%, 'P': 0%, 'S': 8.11%, 'T': 8.11%, 'W': 0%, 'Y': 0%, 'V': 2.7%
Missing Amino Acid(s)
H, P, W, Y
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
N, R, V
Hydrophobic Amino Acid(s) Count
35
Hydrophilic Amino Acid(s) Count
39
Basic Amino Acid(s) Count
11
Acidic Amino Acid(s) Count
8
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8104.39 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 93.649 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 38.807 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.015 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.628 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.498 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -3.174 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.284, 0.189, 0.378 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.054 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 125 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Hu Y, Yu Z, Xu S, et al. Peptidomic analysis of antimicrobial peptides in skin secretions of Amolops mantzorum. Zoolog Sci. 2014;31(3):143-51. Published 2014 Mar. doi:10.2108/zsj.31.143
PMID: 24601776
5.2 Protein Sequence Databases
UniProt: E1AXF5
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: E1AXF5
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. HQ026140 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012521, IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India