AMPDB_322 | Fungal defensin plectasin

1 General Description

AMPDB ID: AMPDB_322

Protein Names: Fungal defensin plectasin

Protein Family: Invertebrate defensin family; Type 2 subfamily

Gene Name: DEF

Source Organism: Pseudoplectania nigrella (Ebony cup) (Peziza nigrella)

Protein Length: 95 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MQFTTILSIGITVFGLLNTGAFAAPQPVPEAYAVSDPEAHPDDFAGMDANQLQKRGFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

FASTA format

Counts of Amino Acids

'A': 9, 'R': 1, 'N': 4, 'D': 7, 'C': 6, 'Q': 5, 'E': 3, 'G': 12, 'H': 3, 'I': 4, 'L': 4, 'K': 6, 'M': 3, 'F': 6, 'P': 6, 'S': 3, 'T': 4, 'W': 1, 'Y': 4, 'V': 4

Frequencies of Amino Acids

'A': 9.47%, 'R': 1.05%, 'N': 4.21%, 'D': 7.37%, 'C': 6.32%, 'Q': 5.26%, 'E': 3.16%, 'G': 12.63%, 'H': 3.16%, 'I': 4.21%, 'L': 4.21%, 'K': 6.32%, 'M': 3.16%, 'F': 6.32%, 'P': 6.32%, 'S': 3.16%, 'T': 4.21%, 'W': 1.05%, 'Y': 4.21%, 'V': 4.21%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10253.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	54.526	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.155	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.274	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.395	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.515	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.098	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.242, 0.263, 0.2 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.116	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11460, 11835	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

S.pneumoniae (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Mygind PH, Fischer RL, Schnorr KM, et al. Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature. 2005;437(7061):975-80. Published 2005 Oct 13. doi:10.1038/nature04051

PMID: 16222292

Citation 2: Andes D, Craig W, Nielsen LA, et al. In vivo pharmacodynamic characterization of a novel plectasin antibiotic, NZ2114, in a murine infection model. Antimicrob Agents Chemother. 2009;53(7):3003-9. Published 2009 Jul. doi:10.1128/AAC.01584-08

PMID: 19414576

Citation 3: Schneider T, Kruse T, Wimmer R, et al. Plectasin, a fungal defensin, targets the bacterial cell wall precursor Lipid II. Science. 2010;328(5982):1168-72. Published 2010 May 28. doi:10.1126/science.1185723

PMID: 20508130

Citation 4: Xiang F, Xie Z, Feng J, et al. Plectasin, first animal toxin-like fungal defensin blocking potassium channels through recognizing channel pore region. Toxins (Basel). 2015;7(1):34-42. Published 2015 Jan 5. doi:10.3390/toxins7010034

PMID: 25568977

Citation 5: Mandal K, Pentelute BL, Tereshko V, et al. Racemic crystallography of synthetic protein enantiomers used to determine the X-ray structure of plectasin by direct methods. Protein Sci. 2009;18(6):1146-54. Published 2009 Jun. doi:10.1002/pro.127

PMID: 19472324

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q53I06

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ964941	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download