AMPDB_32102 | Pleurain-A4

PEPTIDE SUMMARY

Pleurain-A4

1 General Description

AMPDB ID: AMPDB_32102

Protein Names: Pleurain-A4

Protein Family: Frog skin active peptide (FSAP) family; Pleurain subfamily

Gene Name: Nil

Source Organism: Nidirana pleuraden (Yunnan pond frog) (Babina pleuraden)

Protein Length: 69 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKTLLLLFFLGTISISLCKQERDADEDDGRKMTEEEVKRSIITTTKEAKLPQLWKQIACRLYNTC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 4, 'N': 1, 'D': 4, 'C': 3, 'Q': 3, 'E': 6, 'G': 2, 'H': 0, 'I': 5, 'L': 10, 'K': 8, 'M': 2, 'F': 3, 'P': 1, 'S': 3, 'T': 8, 'W': 1, 'Y': 1, 'V': 1

Frequencies of Amino Acids

'A': 4.35%, 'R': 5.8%, 'N': 1.45%, 'D': 5.8%, 'C': 4.35%, 'Q': 4.35%, 'E': 8.7%, 'G': 2.9%, 'H': 0%, 'I': 7.25%, 'L': 14.49%, 'K': 11.59%, 'M': 2.9%, 'F': 4.35%, 'P': 1.45%, 'S': 4.35%, 'T': 11.59%, 'W': 1.45%, 'Y': 1.45%, 'V': 1.45%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

N, P, V, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8055.48 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	93.333	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	58.755	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.304	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.555	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.497	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.821	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.304, 0.101, 0.304 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.072	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7115	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang X, Song Y, Li J, et al. A new family of antimicrobial peptides from skin secretions of Rana pleuraden. Peptides. 2007;28(10):2069-74. Published 2007 Oct. doi:10.1016/j.peptides.2007.07.020

PMID: 17764786

5.2 Protein Sequence Databases

UniProt: A8B5Q0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A8B5Q0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EF621709	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download