AMPDB_321 | Defensin alpha-like protein 1

PEPTIDE SUMMARY

Defensin alpha-like protein 1

1 General Description

AMPDB ID: AMPDB_321

Protein Names: Defensin alpha-like protein 1 (Defensin alpha-related sequence 1) (Rattusin)

Protein Family: Alpha-defensin family

Gene Name: Defal1 Defa-rs1

Source Organism: Rattus norvegicus (Rat)

Protein Length: 87 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTLILLSALVLLALQVQADPIQEAEEETKTEEQPADEDQDVSVSFEGPEASAVQDLRVRRTLQCSCRRVCRNTCSCIRLSRSTYAS

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 8, 'N': 1, 'D': 5, 'C': 5, 'Q': 7, 'E': 9, 'G': 1, 'H': 0, 'I': 3, 'L': 10, 'K': 2, 'M': 1, 'F': 1, 'P': 3, 'S': 9, 'T': 6, 'W': 0, 'Y': 1, 'V': 7

Frequencies of Amino Acids

'A': 9.2%, 'R': 9.2%, 'N': 1.15%, 'D': 5.75%, 'C': 5.75%, 'Q': 8.05%, 'E': 10.34%, 'G': 1.15%, 'H': 0%, 'I': 3.45%, 'L': 11.49%, 'K': 2.3%, 'M': 1.15%, 'F': 1.15%, 'P': 3.45%, 'S': 10.34%, 'T': 6.9%, 'W': 0%, 'Y': 1.15%, 'V': 8.05%

Missing Amino Acid(s)

H, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, G, M, N, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9701.97 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90.805	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	80.162	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.301	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.786	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.45	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.295	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.253, 0.161, 0.322 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.023	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1740	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), K.pneumoniae (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-MRSA, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Patil A, Hughes AL, Zhang G, et al. Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes. Physiol Genomics. 2004;20(1):1-11. Published 2004 Dec 15. doi:10.1152/physiolgenomics.00150.2004

PMID: 15494476

Citation 2: Gibbs RA, Weinstock GM, Metzker ML, et al. Genome sequence of the Brown Norway rat yields insights into mammalian evolution. Nature. 2004;428(6982):493-521. Published 2004 Apr 1. doi:10.1038/nature02426

PMID: 15057822

Citation 3: Patil AA, Ouellette AJ, Lu W, et al. Rattusin, an intestinal Î±-defensin-related peptide in rats with a unique cysteine spacing pattern and salt-insensitive antibacterial activities. Antimicrob Agents Chemother. 2013;57(4):1823-31. Published 2013 Apr. doi:10.1128/AAC.02237-12

PMID: 23380721

Citation 4: Min HJ, Yun H, Ji S, et al. Rattusin structure reveals a novel defensin scaffold formed by intermolecular disulfide exchanges. Sci Rep. 2017;7:45282. Published 2017 Mar 27. doi:10.1038/srep45282

PMID: 28345637

5.2 Protein Sequence Databases

UniProt: Q4JEI2

5.3 3D Structure Databases