AMPDB_32053 | Arasin 2

PEPTIDE SUMMARY

Arasin 2

1 General Description

AMPDB ID: AMPDB_32053

Protein Names: Arasin 2 (Ara-2) (Proline arginine-rich antimicrobial peptide)

Protein Family: Nil

Gene Name: Nil

Source Organism: Hyas araneus (Atlantic lyre crab) (Great spider crab)

Protein Length: 67 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MERRTLLVVLLVCSCVVAAAAEASPSRWPSPGRPRPFPGRPNPIFRPRPCICVRQPCPCDTYGGNRW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 10, 'N': 2, 'D': 1, 'C': 6, 'Q': 1, 'E': 2, 'G': 4, 'H': 0, 'I': 2, 'L': 4, 'K': 0, 'M': 1, 'F': 2, 'P': 12, 'S': 4, 'T': 2, 'W': 2, 'Y': 1, 'V': 6

Frequencies of Amino Acids

'A': 7.46%, 'R': 14.93%, 'N': 2.99%, 'D': 1.49%, 'C': 8.96%, 'Q': 1.49%, 'E': 2.99%, 'G': 5.97%, 'H': 0%, 'I': 2.99%, 'L': 5.97%, 'K': 0%, 'M': 1.49%, 'F': 2.99%, 'P': 17.91%, 'S': 5.97%, 'T': 2.99%, 'W': 2.99%, 'Y': 1.49%, 'V': 8.96%

Missing Amino Acid(s)

H, K

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, M, Q, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7462.81 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.358	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	82.482	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.203	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.426	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.794	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.629	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.254, 0.328, 0.179 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.075	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12865	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.Coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: StensvÃ¥g K, Haug T, Sperstad SV, et al. Arasin 1, a proline-arginine-rich antimicrobial peptide isolated from the spider crab, Hyas araneus. Dev Comp Immunol. 2008;32(3):275-85. Published 2008. doi:10.1016/j.dci.2007.06.002

PMID: 17658600

5.2 Protein Sequence Databases

UniProt: A6XMY1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A6XMY1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	DQ859905	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download