AMPDB_32 | Lysozyme 3

PEPTIDE SUMMARY

Lysozyme 3

1 General Description

AMPDB ID: AMPDB_32

Protein Names: Lysozyme 3 (EC 3.2.1.17) (1;4-beta-N-acetylmuramidase 3) (Invertebrate-type lysozyme 3) (cv-lysozyme 3)

Protein Family: Glycosyl hydrolase 22 family; Type-I lysozyme subfamily

Gene Name: lysoz3

Source Organism: Crassostrea virginica (Eastern oyster)

Protein Length: 187 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNGLFLFCVATTAALAYGSDAPCTNSGGVCQDDHLACHNGHYQSGLCTGGAHRRCCLTSASHTGSFSTGIVSQQCLQCICNVESGCKAIGCHFDVNSDSCGYFQIKEGYWHDCGSPGSSWRSCANDLACASKCVQAYMSRYIGFSGCSHSCESYARIHNGGPAGCKHTNTLGYWSHVHAQGCSHNSK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 16, 'R': 5, 'N': 9, 'D': 7, 'C': 21, 'Q': 8, 'E': 3, 'G': 23, 'H': 13, 'I': 6, 'L': 9, 'K': 5, 'M': 2, 'F': 6, 'P': 3, 'S': 24, 'T': 9, 'W': 3, 'Y': 8, 'V': 7

Frequencies of Amino Acids

'A': 8.56%, 'R': 2.67%, 'N': 4.81%, 'D': 3.74%, 'C': 11.23%, 'Q': 4.28%, 'E': 1.6%, 'G': 12.3%, 'H': 6.95%, 'I': 3.21%, 'L': 4.81%, 'K': 2.67%, 'M': 1.07%, 'F': 3.21%, 'P': 1.6%, 'S': 12.83%, 'T': 4.81%, 'W': 1.6%, 'Y': 4.28%, 'V': 3.74%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

112

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19775 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	50.695	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	52.531	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.204	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.472	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.374	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.122	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.209, 0.316, 0.16 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.091	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	28420, 29670	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriolytic enzyme, Anti-gram-negative

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Xue Q, Hellberg ME, Schey KL, et al. A new lysozyme from the eastern oyster, Crassostrea virginica, and a possible evolutionary pathway for i-type lysozymes in bivalves from host defense to digestion. BMC Evol Biol. 2010;10:213. Published 2010 Jul 15. doi:10.1186/1471-2148-10-213

PMID: 20633278

5.2 Protein Sequence Databases

UniProt: B3A003

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B3A003

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB427186	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008597, IPR023346

PANTHER: PTHR11195

PROSITE: PS51909

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download