AMPDB_3189 | Venom peptide 1

PEPTIDE SUMMARY

Venom peptide 1

1 General Description

AMPDB ID: AMPDB_3189

Protein Names: Venom peptide 1 (EpVP1) (VP1) (Eumenitin VP1)

Protein Family: MCD family; Eumenitin subfamily

Gene Name: Nil

Source Organism: Eumenes pomiformis (Potter wasp) (Vespa pomiformis)

Protein Length: 63 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRGTSFILFAVVVILGFLHANAEPLANPAPLANPDPLANADPLADPEAINLKGLIKKVASLLT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 1, 'N': 5, 'D': 3, 'C': 0, 'Q': 0, 'E': 2, 'G': 3, 'H': 1, 'I': 4, 'L': 11, 'K': 3, 'M': 1, 'F': 3, 'P': 7, 'S': 2, 'T': 2, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 17.46%, 'R': 1.59%, 'N': 7.94%, 'D': 4.76%, 'C': 0%, 'Q': 0%, 'E': 3.17%, 'G': 4.76%, 'H': 1.59%, 'I': 6.35%, 'L': 17.46%, 'K': 4.76%, 'M': 1.59%, 'F': 4.76%, 'P': 11.11%, 'S': 3.17%, 'T': 3.17%, 'W': 0%, 'Y': 0%, 'V': 6.35%

Missing Amino Acid(s)

C, Q, W, Y

Most Occurring Amino Acid(s)

A, L

Less Occurring Amino Acid(s)

H, M, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6545.73 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	128.73	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	13.797	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.586	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.566	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.633	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.907	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.349, 0.27, 0.397 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.048	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Baek JH, Lee SH, Lee SH. Differential gene expression profiles in the venom gland/sac of Eumenes pomiformis (Hymenoptera: Eumenidae). Toxicon. 2010;55(6):1147-56. Published 2010 Jun 1. doi:10.1016/j.toxicon.2010.01.004

PMID: 20096300

Citation 2: Konno K, Kazuma K, Nihei K, et al. Peptide Toxins in Solitary Wasp Venoms. Toxins (Basel). 2016;8(4):114. Published 2016 Apr 18. doi:10.3390/toxins8040114

PMID: 27096870

5.2 Protein Sequence Databases

UniProt: D1MEI6

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: D1MEI6

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	GU136231	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download