AMPDB_3185 | Toxin TdNa5

PEPTIDE SUMMARY

Toxin TdNa5

1 General Description

AMPDB ID: AMPDB_3185

Protein Names: Toxin TdNa5 (T-Arthr*-beta* NaTx2.5)

Protein Family: Long (4 C-C) scorpion toxin superfamily; Sodium channel inhibitor family; Beta subfamily

Gene Name: Nil

Source Organism: Tityus discrepans (Venezuelan scorpion)

Protein Length: 83 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MKTIIFFIACLMLIDVVVESKDGYIIEHRGCKYSCFFGTNSWCNTECTLKKGSSGYCAWPACWCYGLPDNVKIFDSNNNKCGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 1, 'N': 6, 'D': 4, 'C': 9, 'Q': 0, 'E': 3, 'G': 7, 'H': 1, 'I': 7, 'L': 4, 'K': 8, 'M': 2, 'F': 5, 'P': 2, 'S': 6, 'T': 4, 'W': 3, 'Y': 4, 'V': 4

Frequencies of Amino Acids

'A': 3.61%, 'R': 1.2%, 'N': 7.23%, 'D': 4.82%, 'C': 10.84%, 'Q': 0%, 'E': 3.61%, 'G': 8.43%, 'H': 1.2%, 'I': 8.43%, 'L': 4.82%, 'K': 9.64%, 'M': 2.41%, 'F': 6.02%, 'P': 2.41%, 'S': 7.23%, 'T': 4.82%, 'W': 3.61%, 'Y': 4.82%, 'V': 4.82%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9381.93 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	69.277	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	48.143	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.04	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.399	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.908	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.532	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.325, 0.253, 0.145 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.145	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	22460, 22960	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: D'Suze G, Schwartz EF, GarcÃa-GÃ³mez BI, et al. Molecular cloning and nucleotide sequence analysis of genes from a cDNA library of the scorpion Tityus discrepans. Biochimie. 2009;91(8):1010-9. Published 2009 Aug. doi:10.1016/j.biochi.2009.05.005

PMID: 19470401

Citation 2: Guerrero-Vargas JA, MourÃ£o CB, Quintero-HernÃ¡ndez V, et al. Identification and phylogenetic analysis of Tityus pachyurus and Tityus obscurus novel putative Na+-channel scorpion toxins. PLoS One. 2012;7(2):e30478. Published 2012. doi:10.1371/journal.pone.0030478

PMID: 22355312

5.2 Protein Sequence Databases

UniProt: C9X4K3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C9X4K3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FN392281	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR044062, IPR003614, IPR036574, IPR018218, IPR002061

PANTHER: Not found

PROSITE: PS51863

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download