AMPDB_3180 | Palustrin-Ca

PEPTIDE SUMMARY

Palustrin-Ca

1 General Description

AMPDB ID: AMPDB_3180

Protein Names: Palustrin-Ca (Host defense peptide) (HDP)

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: Nil

Source Organism: Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)

Protein Length: 71 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKSLLLLFFLGTISLSLCEQERDADGDEGEVEEVKRGFLDIIKDTGKEFAVKILNNLKCKLAGGCPP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 2, 'D': 5, 'C': 3, 'Q': 1, 'E': 7, 'G': 7, 'H': 0, 'I': 4, 'L': 12, 'K': 8, 'M': 1, 'F': 5, 'P': 2, 'S': 3, 'T': 3, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 4.23%, 'R': 2.82%, 'N': 2.82%, 'D': 7.04%, 'C': 4.23%, 'Q': 1.41%, 'E': 9.86%, 'G': 9.86%, 'H': 0%, 'I': 5.63%, 'L': 16.9%, 'K': 11.27%, 'M': 1.41%, 'F': 7.04%, 'P': 2.82%, 'S': 4.23%, 'T': 4.23%, 'W': 0%, 'Y': 0%, 'V': 4.23%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7847.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	104.366	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	18.396	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.025	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.743	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.741	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.176	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.338, 0.197, 0.324 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.07	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), K.pneumoniae (Gram-negative), Listeria (Gram-positive), S.aureus (Gram-positive), S.suis (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-candida, Anti-listeria, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Timmons PB, Hewage CM, Hewage CM. Conformation and membrane interaction studies of the potent antimicrobial and anticancer peptide palustrin-Ca. Sci Rep. 2021;11(1):22468. Published 2021 Nov 17. doi:10.1038/s41598-021-01769-3

PMID: 34789753

5.2 Protein Sequence Databases

UniProt: C5IB03

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: C5IB03

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FJ830669	GenBank \|\| EMBL
2.	FJ830670	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012521, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download