AMPDB_3174 | Amolopin-P1
PEPTIDE SUMMARY
Amolopin-P1
1 General Description
AMPDB ID: AMPDB_3174
Protein Names: Amolopin-P1
Protein Family: Frog skin active peptide (FSAP) family; Amolopin subfamily
Gene Name: Nil
Protein Length: 62 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MFPMKKSLLLLFFFGPISLSFCDQERGADEEENGGEVTEQEVKRNILSSIVNGINRALSFFG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 2, 'R': 3, 'N': 4, 'D': 2, 'C': 1, 'Q': 2, 'E': 7, 'G': 6, 'H': 0, 'I': 4, 'L': 7, 'K': 3, 'M': 2, 'F': 7, 'P': 2, 'S': 6, 'T': 1, 'W': 0, 'Y': 0, 'V': 3
Frequencies of Amino Acids
'A': 3.23%, 'R': 4.84%, 'N': 6.45%, 'D': 3.23%, 'C': 1.61%, 'Q': 3.23%, 'E': 11.29%, 'G': 9.68%, 'H': 0%, 'I': 6.45%, 'L': 11.29%, 'K': 4.84%, 'M': 3.23%, 'F': 11.29%, 'P': 3.23%, 'S': 9.68%, 'T': 1.61%, 'W': 0%, 'Y': 0%, 'V': 4.84%
Missing Amino Acid(s)
H, W, Y
Most Occurring Amino Acid(s)
E, F, L
Less Occurring Amino Acid(s)
C, T
Hydrophobic Amino Acid(s) Count
33
Hydrophilic Amino Acid(s) Count
29
Basic Amino Acid(s) Count
9
Acidic Amino Acid(s) Count
6
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 6957.95 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 86.452 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 45.571 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.034 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.707 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.39 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -3.052 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.339, 0.29, 0.29 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.113 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.cereus (Gram-positive), B.pumilus (Gram-positive), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-candida, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Wang A, Wang J, Hong J, et al. A novel family of antimicrobial peptides from the skin of Amolops loloensis. Biochimie. 2008;90(6):863-7. Published 2008 Jun. doi:10.1016/j.biochi.2008.02.003
PMID: 18312859
5.2 Protein Sequence Databases
UniProt: C5H0C7
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: C5H0C7
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. EU311540 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India