AMPDB_3165 | Lantibiotic flavucin

PEPTIDE SUMMARY

Lantibiotic flavucin

1 General Description

AMPDB ID: AMPDB_3165

Protein Names: Lantibiotic flavucin

Protein Family: Type A lantibiotic family

Gene Name: flaA HMPREF0298_1795

Source Organism: Corynebacterium lipophiloflavum (strain ATCC 700352 DSM 44291 CCUG 37336 JCM 10383 DMMZ 1944)

Protein Length: 51 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MSDFTLDFAEGDAADTVSPQITSKSLCTPGCITGWMMCNTVTKGCSFTIGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 0, 'N': 1, 'D': 4, 'C': 4, 'Q': 1, 'E': 1, 'G': 5, 'H': 0, 'I': 3, 'L': 2, 'K': 3, 'M': 3, 'F': 3, 'P': 2, 'S': 5, 'T': 8, 'W': 1, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 5.88%, 'R': 0%, 'N': 1.96%, 'D': 7.84%, 'C': 7.84%, 'Q': 1.96%, 'E': 1.96%, 'G': 9.8%, 'H': 0%, 'I': 5.88%, 'L': 3.92%, 'K': 5.88%, 'M': 5.88%, 'F': 5.88%, 'P': 3.92%, 'S': 9.8%, 'T': 15.69%, 'W': 1.96%, 'Y': 0%, 'V': 3.92%

Missing Amino Acid(s)

H, R, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, N, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5369.14 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	55.49	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.81	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.139	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.4	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.193	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.247	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.216, 0.255, 0.176 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.078	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5750	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.faecalis (Gram-positive), E.faecium (Gram-positive), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: van Heel AJ, Kloosterman TG, Montalban-Lopez M, et al. Discovery, Production and Modification of Five Novel Lantibiotics Using the Promiscuous Nisin Modification Machinery. ACS Synth Biol. 2016;5(10):1146-1154. Published 2016 Oct 21. doi:10.1021/acssynbio.6b00033

PMID: 27294279

5.2 Protein Sequence Databases

UniProt: C0XTM5

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C0XTM5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	ACHJ01000147	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download