AMPDB_3164 | Anti-lipopolysaccharide factor

PEPTIDE SUMMARY

Anti-lipopolysaccharide factor

1 General Description

AMPDB ID: AMPDB_3164

Protein Names: Anti-lipopolysaccharide factor (PtALF)

Protein Family: Nil

Gene Name: ALF

Source Organism: Portunus trituberculatus (Swimming crab) (Neptunus trituberculatus)

Protein Length: 123 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MRKGVVAGLCLALVVMCLYLPQPCEAQYEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRSRTKSRSGSSREATKDFVRKALQNGLVTQQDASLWLNN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 11, 'N': 4, 'D': 4, 'C': 5, 'Q': 5, 'E': 5, 'G': 10, 'H': 3, 'I': 3, 'L': 14, 'K': 8, 'M': 3, 'F': 6, 'P': 5, 'S': 8, 'T': 5, 'W': 4, 'Y': 4, 'V': 8

Frequencies of Amino Acids

'A': 6.5%, 'R': 8.94%, 'N': 3.25%, 'D': 3.25%, 'C': 4.07%, 'Q': 4.07%, 'E': 4.07%, 'G': 8.13%, 'H': 2.44%, 'I': 2.44%, 'L': 11.38%, 'K': 6.5%, 'M': 2.44%, 'F': 4.88%, 'P': 4.07%, 'S': 6.5%, 'T': 4.07%, 'W': 3.25%, 'Y': 3.25%, 'V': 6.5%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, I, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14109.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	79.268	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	59.196	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.279	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.654	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.241	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.966	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.317, 0.22, 0.244 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.114	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	27960, 28210	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Yue F, Pan L, Miao J, et al. Molecular cloning, characterization and mRNA expression of two antibacterial peptides: crustin and anti-lipopolysaccharide factor in swimming crab Portunus trituberculatus. Comp Biochem Physiol B Biochem Mol Biol. 2010;156(2):77-85. Published 2010 Jun. doi:10.1016/j.cbpb.2010.02.003

PMID: 20167286

Citation 2: Liu Y, Cui Z, Luan W, et al. Three isoforms of anti-lipopolysaccharide factor identified from eyestalk cDNA library of swimming crab Portunus trituberculatus. Fish Shellfish Immunol. 2011;30(2):583-91. Published 2011 Feb. doi:10.1016/j.fsi.2010.12.005

PMID: 21168510

5.2 Protein Sequence Databases

UniProt: C0KJQ4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C0KJQ4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FJ612108	GenBank \|\| EMBL
2.	GQ165621	GenBank \|\| EMBL
3.	HM536671	GenBank \|\| EMBL
4.	HM536672	GenBank \|\| EMBL
5.	HM536673	GenBank \|\| EMBL
6.	HM536674	GenBank \|\| EMBL
7.	HM536675	GenBank \|\| EMBL
8.	HM536676	GenBank \|\| EMBL
9.	HM536677	GenBank \|\| EMBL
10.	HM536678	GenBank \|\| EMBL
11.	HM536679	GenBank \|\| EMBL
12.	HM536680	GenBank \|\| EMBL
13.	HM536681	GenBank \|\| EMBL
14.	HM536682	GenBank \|\| EMBL
15.	HM536683	GenBank \|\| EMBL
16.	HM536684	GenBank \|\| EMBL
17.	HM536685	GenBank \|\| EMBL
18.	HM536686	GenBank \|\| EMBL
19.	HM536687	GenBank \|\| EMBL
20.	HM536688	GenBank \|\| EMBL
21.	HM536689	GenBank \|\| EMBL
22.	HM536690	GenBank \|\| EMBL
23.	HM536691	GenBank \|\| EMBL
24.	HM536692	GenBank \|\| EMBL
25.	HM536693	GenBank \|\| EMBL
26.	HM536694	GenBank \|\| EMBL
27.	HM536695	GenBank \|\| EMBL
28.	HM536696	GenBank \|\| EMBL
29.	HM536697	GenBank \|\| EMBL
30.	HM536698	GenBank \|\| EMBL
31.	HM536699	GenBank \|\| EMBL
32.	HM536700	GenBank \|\| EMBL
33.	HM627757	GenBank \|\| EMBL
34.	HM627758	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR024509, IPR038539

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download