AMPDB_315 | Cathelicidin-2

PEPTIDE SUMMARY

Cathelicidin-2

1 General Description

AMPDB ID: AMPDB_315

Protein Names: Cathelicidin-2 (CATH-2) (Fowlicidin-2) (Myeloid antimicrobial peptide 27)

Protein Family: Cathelicidin family

Gene Name: CATHL2 CMAP27

Source Organism: Gallus gallus (Chicken)

Protein Length: 154 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MLSCWVLLLALLGGVCALPAPLSYPQALIQAVDSYNQRPEVQNAFRLLSADPEPGPGVDLSTLRALNFTIMETECTPSARLPVDDCDFKENGVIRDCSGPVSVLQDTPEINLRCRDASSDPVLVQRGRFGRFLRKIRRFRPKVTITIQGSARFG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 15, 'N': 5, 'D': 10, 'C': 6, 'Q': 7, 'E': 6, 'G': 10, 'H': 0, 'I': 7, 'L': 19, 'K': 3, 'M': 2, 'F': 7, 'P': 13, 'S': 11, 'T': 7, 'W': 1, 'Y': 2, 'V': 12

Frequencies of Amino Acids

'A': 7.14%, 'R': 9.74%, 'N': 3.25%, 'D': 6.49%, 'C': 3.9%, 'Q': 4.55%, 'E': 3.9%, 'G': 6.49%, 'H': 0%, 'I': 4.55%, 'L': 12.34%, 'K': 1.95%, 'M': 1.3%, 'F': 4.55%, 'P': 8.44%, 'S': 7.14%, 'T': 4.55%, 'W': 0.65%, 'Y': 1.3%, 'V': 7.79%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16974.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	95.584	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.529	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.045	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	1.064	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.108	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.639	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.312, 0.253, 0.247 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.065	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: van Dijk A, Veldhuizen EJ, van Asten AJ, et al. CMAP27, a novel chicken cathelicidin-like antimicrobial protein. Vet Immunol Immunopathol. 2005;106(3-4):321-7. Published 2005 Jul 15. doi:10.1016/j.vetimm.2005.03.003

PMID: 15963828

Citation 2: Xiao Y, Cai Y, Bommineni YR, et al. Identification and functional characterization of three chicken cathelicidins with potent antimicrobial activity. J Biol Chem. 2006;281(5):2858-67. Published 2006 Feb 3. doi:10.1074/jbc.M507180200

PMID: 16326712

5.2 Protein Sequence Databases

UniProt: Q2IAL7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q2IAL7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY817057	GenBank \|\| EMBL
2.	DQ092352	GenBank \|\| EMBL
3.	DQ092350	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001020001.2

5.5 Protein-Protein Interaction Databases

STRING: 9031.ENSGALP00000030658

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR046350

PANTHER: PTHR10206

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: gga:420407

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download