AMPDB_3131 | Antimicrobial peptide D1

PEPTIDE SUMMARY

Antimicrobial peptide D1

1 General Description

AMPDB ID: AMPDB_3131

Protein Names: Antimicrobial peptide D1 (Sm-AMP-D1) (Sm-D1)

Protein Family: DEFL family

Gene Name: Nil

Source Organism: Stellaria media (Common chickweed) (Alsine media)

Protein Length: 81 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAKTVLGIHVTFLTLLFAVLLLNDVMYTPVEKICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFDC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 1, 'N': 6, 'D': 3, 'C': 8, 'Q': 2, 'E': 3, 'G': 5, 'H': 3, 'I': 4, 'L': 7, 'K': 4, 'M': 3, 'F': 5, 'P': 2, 'S': 4, 'T': 5, 'W': 2, 'Y': 4, 'V': 6

Frequencies of Amino Acids

'A': 4.94%, 'R': 1.23%, 'N': 7.41%, 'D': 3.7%, 'C': 9.88%, 'Q': 2.47%, 'E': 3.7%, 'G': 6.17%, 'H': 3.7%, 'I': 4.94%, 'L': 8.64%, 'K': 4.94%, 'M': 3.7%, 'F': 6.17%, 'P': 2.47%, 'S': 4.94%, 'T': 6.17%, 'W': 2.47%, 'Y': 4.94%, 'V': 7.41%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9208.72 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	79.383	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	30.8	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.236	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.556	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.717	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.223	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.346, 0.21, 0.21 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.136	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	16960, 17460	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cinerea, B.sorokiniana, F.avenaceum, F.graminearum, F.oxysporum, P.beta, P.infestans

4.2 Antimicrobial Activity

Antimicrobial, Fungicide

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Slavokhotova AA, Odintsova TI, Rogozhin EA, et al. Isolation, molecular cloning and antimicrobial activity of novel defensins from common chickweed (Stellaria media L.) seeds. Biochimie. 2011;93(3):450-6. Published 2011 Mar. doi:10.1016/j.biochi.2010.10.019

PMID: 21056078

5.2 Protein Sequence Databases

UniProt: C0HL82

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C0HL82

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008176, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS00940

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download