AMPDB_313 | M-myrmeciitoxin-Mp2a

1 General Description

AMPDB ID: AMPDB_313

Protein Names: M-myrmeciitoxin-Mp2a (M-MIITX-Mp2a) (Allergen Myr p II) (DELTA-myrtoxin-Mp1a A chain) (Mp1a A chain) (Pilosin-3 subunit a) (Pilosulin-3a) (Pilosulin-2) (allergen Myr p 2)

Protein Family: Formicidae venom precursor-01 superfamily; Ant pilosulin family

Gene Name: Nil

Source Organism: Myrmecia pilosula (Jack jumper ant) (Australian jumper ant)

Protein Length: 75 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKLSCLLLTLAIIFVLTIVHAPNVEAKALADPESDAVGFADAVGEADPIDWKKVDWKKVSKKTCKVMLKACKFLG

FASTA format

Counts of Amino Acids

'A': 10, 'R': 0, 'N': 1, 'D': 6, 'C': 3, 'Q': 0, 'E': 3, 'G': 3, 'H': 1, 'I': 4, 'L': 9, 'K': 11, 'M': 2, 'F': 3, 'P': 3, 'S': 3, 'T': 3, 'W': 2, 'Y': 0, 'V': 8

Frequencies of Amino Acids

'A': 13.33%, 'R': 0%, 'N': 1.33%, 'D': 8%, 'C': 4%, 'Q': 0%, 'E': 4%, 'G': 4%, 'H': 1.33%, 'I': 5.33%, 'L': 12%, 'K': 14.67%, 'M': 2.67%, 'F': 4%, 'P': 4%, 'S': 4%, 'T': 4%, 'W': 2.67%, 'Y': 0%, 'V': 10.67%

Missing Amino Acid(s)

Q, R, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8144.79 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	111.867	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	14.632	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.401	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.629	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.505	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.908	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.347, 0.133, 0.32 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.067	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11000, 11125	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

D.melanogaster, H.contortus

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Insecticidal, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Street MD, Donovan GR, Baldo BA, et al. Molecular cloning and characterization of the major allergen Myr p II from the venom of the jumper ant Myrmecia pilosula: Myr p I and Myr p II share a common protein leader sequence. Biochim Biophys Acta. 1996;1305(1-2):87-97. Published 1996 Feb 7. doi:10.1016/0167-4781(95)00197-2

PMID: 8605256

Citation 2: Donovan GR, Street MD, Tetaz T, et al. Expression of jumper ant (Myrmecia pilosula) venom allergens: post-translational processing of allergen gene products. Biochem Mol Biol Int. 1996;39(5):877-85. Published 1996 Aug. doi:10.1080/15216549600201022

PMID: 8866004

Citation 3: Davies NW, Wiese MD, Brown SG, et al. Characterisation of major peptides in 'jack jumper' ant venom by mass spectrometry. Toxicon. 2004;43(2):173-83. Published 2004 Feb. doi:10.1016/j.toxicon.2003.11.021

PMID: 15019477

Citation 4: Touchard A, Aili SR, Fox EG, et al. The Biochemical Toxin Arsenal from Ant Venoms. Toxins (Basel). 2016;8(1). Published 2016 Jan 20. doi:10.3390/toxins8010030

PMID: 26805882

Citation 5: Nixon SA, Dekan Z, Robinson SD, et al. It Takes Two: Dimerization Is Essential for the Broad-Spectrum Predatory and Defensive Activities of the Venom Peptide Mp1a from the Jack Jumper Ant Myrmecia pilosula. Biomedicines. 2020;8(7). Published 2020 Jun 30. doi:10.3390/biomedicines8070185

PMID: 32629771

Citation 6: Dekan Z, Headey SJ, Scanlon M, et al. Î-Myrtoxin-Mp1a is a Helical Heterodimer from the Venom of the Jack Jumper Ant that has Antimicrobial, Membrane-Disrupting, and Nociceptive Activities. Angew Chem Int Ed Engl. 2017;56(29):8495-8499. Published 2017 Jul 10. doi:10.1002/anie.201703360

PMID: 28513074

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q26464

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	S81785	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download