AMPDB_312 | Metchnikowin
PEPTIDE SUMMARY
Metchnikowin
1 General Description
AMPDB ID: AMPDB_312
Protein Names: Metchnikowin
Protein Family: Nil
Gene Name: Mtk CG8175
Source Organism: Drosophila melanogaster (Fruit fly)
Protein Length: 52 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGPIY
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 5, 'R': 3, 'N': 3, 'D': 1, 'C': 0, 'Q': 3, 'E': 1, 'G': 4, 'H': 2, 'I': 3, 'L': 6, 'K': 0, 'M': 2, 'F': 3, 'P': 8, 'S': 2, 'T': 3, 'W': 0, 'Y': 1, 'V': 2
Frequencies of Amino Acids
'A': 9.62%, 'R': 5.77%, 'N': 5.77%, 'D': 1.92%, 'C': 0%, 'Q': 5.77%, 'E': 1.92%, 'G': 7.69%, 'H': 3.85%, 'I': 5.77%, 'L': 11.54%, 'K': 0%, 'M': 3.85%, 'F': 5.77%, 'P': 15.38%, 'S': 3.85%, 'T': 5.77%, 'W': 0%, 'Y': 1.92%, 'V': 3.85%
Missing Amino Acid(s)
C, K, W
Most Occurring Amino Acid(s)
P
Less Occurring Amino Acid(s)
D, E, Y
Hydrophobic Amino Acid(s) Count
33
Hydrophilic Amino Acid(s) Count
19
Basic Amino Acid(s) Count
2
Acidic Amino Acid(s) Count
5
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 5653.57 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 88.269 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 39.504 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.027 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.422 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 9.351 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 1.181 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.288, 0.327, 0.269 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.077 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1490 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Levashina EA, Ohresser S, Bulet P, et al. Metchnikowin, a novel immune-inducible proline-rich peptide from Drosophila with antibacterial and antifungal properties. Eur J Biochem. 1995;233(2):694-700. Published 1995 Oct 15. doi:10.1111/j.1432-1033.1995.694_2.x
PMID: 7588819
Citation 2: Levashina EA, Ohresser S, Lemaitre B, et al. Two distinct pathways can control expression of the gene encoding the Drosophila antimicrobial peptide metchnikowin. J Mol Biol. 1998;278(3):515-27. Published 1998 May 8. doi:10.1006/jmbi.1998.1705
PMID: 9600835
Citation 3: Lazzaro BP, Clark AG, Clark AG. Molecular population genetics of inducible antibacterial peptide genes in Drosophila melanogaster. Mol Biol Evol. 2003;20(6):914-23. Published 2003 Jun. doi:10.1093/molbev/msg109
PMID: 12716986
Citation 4: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185
PMID: 10731132
Citation 5: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083
PMID: 12537572
Citation 6: Stapleton M, Carlson J, Brokstein P, et al. A Drosophila full-length cDNA resource. Genome Biol. 2002;3(12):RESEARCH0080. Published 2002. doi:10.1186/gb-2002-3-12-research0080
PMID: 12537569
Citation 7: Uttenweiler-Joseph S, Moniatte M, Lagueux M, et al. Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study. Proc Natl Acad Sci U S A. 1998;95(19):11342-7. Published 1998 Sep 15. doi:10.1073/pnas.95.19.11342
PMID: 9736738
5.2 Protein Sequence Databases
UniProt: Q24395
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: Q24395
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. X91060 GenBank || EMBL
2. X91061 GenBank || EMBL
3. AF030959 GenBank || EMBL
4. AY224619 GenBank || EMBL
5. AY224620 GenBank || EMBL
6. AY224621 GenBank || EMBL
7. AY224622 GenBank || EMBL
8. AY224623 GenBank || EMBL
9. AY224624 GenBank || EMBL
10. AY224625 GenBank || EMBL
11. AY224626 GenBank || EMBL
12. AY224627 GenBank || EMBL
13. AY224628 GenBank || EMBL
14. AY224629 GenBank || EMBL
15. AY224630 GenBank || EMBL
16. AE013599 GenBank || EMBL
17. AY075536 GenBank || EMBL
CCDS: Not found
RefSeq: NP_523752.1
5.5 Protein-Protein Interaction Databases
STRING: 7227.FBpp0086518
IntAct: Not found
MINT: Not found
DIP: DIP-23804N
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012513
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: dme:Dmel_CG8175
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India