AMPDB_3047 | Adenoregulin-related peptide

PEPTIDE SUMMARY

Adenoregulin-related peptide

1 General Description

AMPDB ID: AMPDB_3047

Protein Names: Adenoregulin-related peptide (ARP-AC1)

Protein Family: Frog skin active peptide (FSAP) family; Dermaseptin subfamily

Gene Name: Nil

Source Organism: Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas)

Protein Length: 81 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLLLVLFLGLVSLSICEEEKRENEDEEEQEDDEQSEMKRGMWSKIKEAGKAAAKAAAKAAGKAALDVVSGAIGEQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 2, 'N': 1, 'D': 4, 'C': 1, 'Q': 3, 'E': 13, 'G': 6, 'H': 0, 'I': 3, 'L': 9, 'K': 10, 'M': 3, 'F': 2, 'P': 0, 'S': 6, 'T': 0, 'W': 1, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 16.05%, 'R': 2.47%, 'N': 1.23%, 'D': 4.94%, 'C': 1.23%, 'Q': 3.7%, 'E': 16.05%, 'G': 7.41%, 'H': 0%, 'I': 3.7%, 'L': 11.11%, 'K': 12.35%, 'M': 3.7%, 'F': 2.47%, 'P': 0%, 'S': 7.41%, 'T': 0%, 'W': 1.23%, 'Y': 0%, 'V': 4.94%

Missing Amino Acid(s)

H, P, T, Y

Most Occurring Amino Acid(s)

A, E

Less Occurring Amino Acid(s)

C, N, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8770.01 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	88.148	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.349	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.344	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.629	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.452	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-5.042	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.235, 0.16, 0.469 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.037	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), M.luteus (Gram-negative)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang L, Zhou M, McClelland A, et al. Novel dermaseptin, adenoregulin and caerin homologs from the Central American red-eyed leaf frog, Agalychnis callidryas, revealed by functional peptidomics of defensive skin secretion. Biochimie. 2008;90(10):1435-41. Published 2008 Oct. doi:10.1016/j.biochi.2008.04.016

PMID: 18555027

5.2 Protein Sequence Databases

UniProt: B6HY15

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B6HY15

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AM944841	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download