AMPDB_304 | Puroindoline-B

PEPTIDE SUMMARY

Puroindoline-B

1 General Description

AMPDB ID: AMPDB_304

Protein Names: Puroindoline-B

Protein Family: Nil

Gene Name: PINB

Source Organism: Triticum aestivum (Wheat)

Protein Length: 148 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTLFLLALLALVASTTFAQYSEVGGWYNEVGGGGGSQQCPQERPKLSSCKDYVMERCFTMKDFPVTWPTKWWKGGCEHEVREKCCKQLSQIAPQCRCDSIRRVIQGRLGGFLGIWRGEVFKQLQRAQSLPSKCNMGADCKFPSGYYW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 9, 'N': 2, 'D': 4, 'C': 10, 'Q': 11, 'E': 8, 'G': 16, 'H': 1, 'I': 4, 'L': 12, 'K': 11, 'M': 4, 'F': 7, 'P': 7, 'S': 10, 'T': 6, 'W': 6, 'Y': 5, 'V': 8

Frequencies of Amino Acids

'A': 4.73%, 'R': 6.08%, 'N': 1.35%, 'D': 2.7%, 'C': 6.76%, 'Q': 7.43%, 'E': 5.41%, 'G': 10.81%, 'H': 0.68%, 'I': 2.7%, 'L': 8.11%, 'K': 7.43%, 'M': 2.7%, 'F': 4.73%, 'P': 4.73%, 'S': 6.76%, 'T': 4.05%, 'W': 4.05%, 'Y': 3.38%, 'V': 5.41%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16792.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	62.568	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.916	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.364	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.63	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.86	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.478	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.284, 0.236, 0.209 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.122	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	40450, 41075	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.tumefaciens (Gram-negative), C.michiganensis (Gram-positive), E.coli (Gram-negative), P.syringae (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Plant defense, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Synergistic peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Gautier MF, Aleman ME, Guirao A, et al. Triticum aestivum puroindolines, two basic cystine-rich seed proteins: cDNA sequence analysis and developmental gene expression. Plant Mol Biol. 1994;25(1):43-57. Published 1994 Apr. doi:10.1007/BF00024197

PMID: 7516201

Citation 2: Charnet P, Molle G, Marion D, et al. Puroindolines form ion channels in biological membranes. Biophys J. 2003;84(4):2416-26. Published 2003 Apr. doi:10.1016/S0006-3495(03)75046-2

PMID: 12668449

Citation 3: Capparelli R, Amoroso MG, Palumbo D, et al. Two plant puroindolines colocalize in wheat seed and in vitro synergistically fight against pathogens. Plant Mol Biol. 2005;58(6):857-867. Published 2005 Aug. doi:10.1007/s11103-005-8270-9

PMID: 16240178

Citation 4: Day L, Bhandari DG, Greenwell P, et al. Characterization of wheat puroindoline proteins. FEBS J. 2006;273(23):5358-73. Published 2006 Dec. doi:10.1111/j.1742-4658.2006.05528.x

PMID: 17076702

5.2 Protein Sequence Databases

UniProt: Q10464

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q10464

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X69912	GenBank \|\| EMBL
2.	AJ302100	GenBank \|\| EMBL
3.	DQ363913	GenBank \|\| EMBL
4.	DQ363914	GenBank \|\| EMBL
5.	AB177390	GenBank \|\| EMBL
6.	AB180737	GenBank \|\| EMBL
7.	AY598029	GenBank \|\| EMBL
8.	AY640304	GenBank \|\| EMBL
9.	CR626934	GenBank \|\| EMBL
10.	CT009735	GenBank \|\| EMBL
11.	AB262660	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR044723, IPR006106, IPR036312, IPR016140, IPR001954

PANTHER: PTHR33454

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download