AMPDB_3039 | Peptidoglycan recognition protein 1

PEPTIDE SUMMARY

Peptidoglycan recognition protein 1

1 General Description

AMPDB ID: AMPDB_3039

Protein Names: Peptidoglycan recognition protein 1

Protein Family: N-acetylmuramoyl-L-alanine amidase 2 family

Gene Name: PGLYRP1

Source Organism: Bos indicus (Zebu)

Protein Length: 190 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MSRRYTPLAWVLLALLGLGAAQDCGSIVSRGKWGALASKCSQRLRQPVRYVVVSHTAGSVCNTPASCQRQAQNVQHYHVRERGWCDVGYNFLIGEDGLVYEGRGWNTLGAHSGPTWNPIAIGISFMGNYMHRVPPASALRAAQSLLACGAARGYLTPNYEVKGHRDVQQTLSPGDELYKIIQQWPHYRRV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 18, 'R': 16, 'N': 7, 'D': 5, 'C': 6, 'Q': 12, 'E': 5, 'G': 20, 'H': 7, 'I': 7, 'L': 17, 'K': 4, 'M': 3, 'F': 2, 'P': 10, 'S': 13, 'T': 7, 'W': 6, 'Y': 10, 'V': 15

Frequencies of Amino Acids

'A': 9.47%, 'R': 8.42%, 'N': 3.68%, 'D': 2.63%, 'C': 3.16%, 'Q': 6.32%, 'E': 2.63%, 'G': 10.53%, 'H': 3.68%, 'I': 3.68%, 'L': 8.95%, 'K': 2.11%, 'M': 1.58%, 'F': 1.05%, 'P': 5.26%, 'S': 6.84%, 'T': 3.68%, 'W': 3.16%, 'Y': 5.26%, 'V': 7.89%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	21037 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.632	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.063	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.271	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.696	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.742	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.264	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.3, 0.263, 0.226 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	47900, 48275	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Chemotaxis, Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Seabury CM, Womack JE, Womack JE. Analysis of sequence variability and protein domain architectures for bovine peptidoglycan recognition protein 1 and Toll-like receptors 2 and 6. Genomics. 2008;92(4):235-45. Published 2008 Oct. doi:10.1016/j.ygeno.2008.06.005

PMID: 18639626

5.2 Protein Sequence Databases

UniProt: B5T255

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B5T255

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU746449	GenBank \|\| EMBL
2.	EU746453	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_019834179.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036505, IPR002502, IPR017331, IPR015510, IPR006619

PANTHER: PTHR11022

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: biu:109572082

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download