AMPDB_3032 | Dybowskin-2CDYa
PEPTIDE SUMMARY
Dybowskin-2CDYa
1 General Description
AMPDB ID: AMPDB_3032
Protein Names: Dybowskin-2CDYa
Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily
Gene Name: Nil
Protein Length: 65 AA
Protein Existence: Evidence at transcript level
2 Protein Sequence & Composition
2.1 Sequence
MFTLKKSLLLLFFIGVIKLSLCEEERNADDDERRDDPDEMDVEVENRSAVGRHGRRFGLRKHRKH
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 2, 'R': 9, 'N': 2, 'D': 7, 'C': 1, 'Q': 0, 'E': 7, 'G': 4, 'H': 3, 'I': 2, 'L': 8, 'K': 5, 'M': 2, 'F': 4, 'P': 1, 'S': 3, 'T': 1, 'W': 0, 'Y': 0, 'V': 4
Frequencies of Amino Acids
'A': 3.08%, 'R': 13.85%, 'N': 3.08%, 'D': 10.77%, 'C': 1.54%, 'Q': 0%, 'E': 10.77%, 'G': 6.15%, 'H': 4.62%, 'I': 3.08%, 'L': 12.31%, 'K': 7.69%, 'M': 3.08%, 'F': 6.15%, 'P': 1.54%, 'S': 4.62%, 'T': 1.54%, 'W': 0%, 'Y': 0%, 'V': 6.15%
Missing Amino Acid(s)
Q, W, Y
Most Occurring Amino Acid(s)
R
Less Occurring Amino Acid(s)
C, P, T
Hydrophobic Amino Acid(s) Count
27
Hydrophilic Amino Acid(s) Count
38
Basic Amino Acid(s) Count
14
Acidic Amino Acid(s) Count
17
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7725.81 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 80.923 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 42.8 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.84 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.749 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.62 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.223 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.277, 0.154, 0.292 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.062 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Jin LL, Li Q, Song SS, et al. Characterization of antimicrobial peptides isolated from the skin of the Chinese frog, Rana dybowskii. Comp Biochem Physiol B Biochem Mol Biol. 2009;154(2):174-8. Published 2009 Oct. doi:10.1016/j.cbpb.2009.05.015
PMID: 19539775
5.2 Protein Sequence Databases
UniProt: B5A9T1
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: B5A9T1
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. EU827809 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India