AMPDB_302 | Peptidoglycan recognition protein 4

PEPTIDE SUMMARY

Peptidoglycan recognition protein 4

1 General Description

AMPDB ID: AMPDB_302

Protein Names: Peptidoglycan recognition protein 4 (Peptidoglycan recognition protein I-beta) (PGLYRPIbeta) (PGRP-I-beta) (Peptidoglycan recognition protein intermediate beta)

Protein Family: N-acetylmuramoyl-L-alanine amidase 2 family

Gene Name: Pglyrp4 Pgrpib

Source Organism: Mus musculus (Mouse)

Protein Length: 374 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MLSWLLVFSILVLLAQGVSSWENPQTDQVSEGLQQLFGNISQLFEKGILGRDDVFTMVSREEWGAEAIGCSSKLSRPVDVLVIHHIPGLECHNKTVCSQKLRELQAYHIHNSWCDVAYNFLVGDDGRVYEGVGWNVQGSHDQGYKNISLGVAFFGTQEGHSPSPVALSAMKGLISYAVKKGHLSSKYIQPLLAKSEDCLVPPQKGKQKKACPHIVPRSVWGARDSHCSRMTLPAKYAIILHTAGRTCSQPDECRLLVRDLQSFFMNRLNACDIGYNFLVGQDGGVYEGVGWNNQGSKTDSYNDISLSITFMGTFTGSPPNAAALEAAQDLIRCAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHFKH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 23, 'R': 13, 'N': 17, 'D': 18, 'C': 11, 'Q': 20, 'E': 14, 'G': 34, 'H': 14, 'I': 19, 'L': 38, 'K': 19, 'M': 7, 'F': 13, 'P': 17, 'S': 34, 'T': 14, 'W': 8, 'Y': 13, 'V': 28

Frequencies of Amino Acids

'A': 6.15%, 'R': 3.48%, 'N': 4.55%, 'D': 4.81%, 'C': 2.94%, 'Q': 5.35%, 'E': 3.74%, 'G': 9.09%, 'H': 3.74%, 'I': 5.08%, 'L': 10.16%, 'K': 5.08%, 'M': 1.87%, 'F': 3.48%, 'P': 4.55%, 'S': 9.09%, 'T': 3.74%, 'W': 2.14%, 'Y': 3.48%, 'V': 7.49%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

187

Hydrophilic Amino Acid(s) Count

187

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	41190 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.3	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.837	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.146	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.735	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.533	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.605	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.318, 0.273, 0.219 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.091	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	63370, 63995	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Mathur P, Murray B, Crowell T, et al. Murine peptidoglycan recognition proteins PglyrpIalpha and PglyrpIbeta are encoded in the epidermal differentiation complex and are expressed in epidermal and hematopoietic tissues. Genomics. 2004;83(6):1151-63. Published 2004 Jun. doi:10.1016/j.ygeno.2004.01.003

PMID: 15177568

Citation 2: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

5.2 Protein Sequence Databases

UniProt: Q0VB07

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q0VB07

5.4 Nucleotide Sequence Databases