AMPDB_3000 | Esculentin-2JDa

PEPTIDE SUMMARY

Esculentin-2JDa

1 General Description

AMPDB ID: AMPDB_3000

Protein Names: Esculentin-2JDa

Protein Family: Frog skin active peptide (FSAP) family; Esculentin subfamily

Gene Name: Nil

Source Organism: Odorrana jingdongensis (Jingdong frog) (Rana jingdongensis)

Protein Length: 37 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 0, 'N': 1, 'D': 0, 'C': 2, 'Q': 1, 'E': 2, 'G': 5, 'H': 0, 'I': 3, 'L': 5, 'K': 6, 'M': 1, 'F': 1, 'P': 0, 'S': 0, 'T': 4, 'W': 0, 'Y': 0, 'V': 1

Frequencies of Amino Acids

'A': 13.51%, 'R': 0%, 'N': 2.7%, 'D': 0%, 'C': 5.41%, 'Q': 2.7%, 'E': 5.41%, 'G': 13.51%, 'H': 0%, 'I': 8.11%, 'L': 13.51%, 'K': 16.22%, 'M': 2.7%, 'F': 2.7%, 'P': 0%, 'S': 0%, 'T': 10.81%, 'W': 0%, 'Y': 0%, 'V': 2.7%

Missing Amino Acid(s)

D, H, P, R, S, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, M, N, Q, V

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3821.65 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	105.676	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	-1.554	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.357	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.644	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.138	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.876	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.27, 0.162, 0.351 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.027	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Liu J, Jiang J, Wu Z, et al. Antimicrobial peptides from the skin of the Asian frog, Odorrana jingdongensis: de novo sequencing and analysis of tandem mass spectrometry data. J Proteomics. 2012;75(18):5807-21. Published 2012 Oct 22. doi:10.1016/j.jprot.2012.08.004

PMID: 22917879

5.2 Protein Sequence Databases

UniProt: B3A0M8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B3A0M8

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012521

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download