AMPDB_30 | Arasin 1

PEPTIDE SUMMARY

Arasin 1

1 General Description

AMPDB ID: AMPDB_30

Protein Names: Arasin 1 (Ara-1) (Proline-rich antimicrobial peptide) (PR-AMP) (Pro-rich AMP)

Protein Family: Nil

Gene Name: Nil

Source Organism: Hyas araneus (Atlantic lyre crab) (Great spider crab)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MERRTLLVVLLVCSCVVAAAAEASPSRWPSPGRPRPFPGRPKPIFRPRPCNCYAPPCPCDRWRH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 10, 'N': 1, 'D': 1, 'C': 6, 'Q': 0, 'E': 2, 'G': 2, 'H': 1, 'I': 1, 'L': 4, 'K': 1, 'M': 1, 'F': 2, 'P': 13, 'S': 4, 'T': 1, 'W': 2, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 9.38%, 'R': 15.63%, 'N': 1.56%, 'D': 1.56%, 'C': 9.38%, 'Q': 0%, 'E': 3.13%, 'G': 3.13%, 'H': 1.56%, 'I': 1.56%, 'L': 6.25%, 'K': 1.56%, 'M': 1.56%, 'F': 3.13%, 'P': 20.31%, 'S': 6.25%, 'T': 1.56%, 'W': 3.13%, 'Y': 1.56%, 'V': 7.81%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, I, K, M, N, T, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7226.58 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	62.5	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	94.484	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.323	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.454	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.444	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.72	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.234, 0.313, 0.203 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.078	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12865	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.Coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: StensvÃ¥g K, Haug T, Sperstad SV, et al. Arasin 1, a proline-arginine-rich antimicrobial peptide isolated from the spider crab, Hyas araneus. Dev Comp Immunol. 2008;32(3):275-85. Published 2008. doi:10.1016/j.dci.2007.06.002

PMID: 17658600

Citation 2: Paulsen VS, Blencke HM, Benincasa M, et al. Structure-activity relationships of the antimicrobial peptide arasin 1 - and mode of action studies of the N-terminal, proline-rich region. PLoS One. 2013;8(1):e53326. Published 2013. doi:10.1371/journal.pone.0053326

PMID: 23326415

Citation 3: Paulsen VS, Mardirossian M, Blencke HM, et al. Inner membrane proteins YgdD and SbmA are required for the complete susceptibility of Escherichia coli to the proline-rich antimicrobial peptide arasin 1(1-25). Microbiology (Reading). 2016;162(4):601-609. Published 2016 Apr. doi:10.1099/mic.0.000249

PMID: 26860543

5.2 Protein Sequence Databases

UniProt: A6XMY0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A6XMY0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	DQ859904	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download