AMPDB_3 | Antimicrobial peptide AcrAP1

PEPTIDE SUMMARY

Antimicrobial peptide AcrAP1

1 General Description

AMPDB ID: AMPDB_3

Protein Names: Antimicrobial peptide AcrAP1

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Androctonus crassicauda (Arabian fat-tailed scorpion)

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MEIKYLLTVFLVLLIVSDHCQAFLFSLIPHAISGLISAFKGRRKRDLDGQIDRFRNFRKRDAELEELLSKLPIY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 7, 'N': 1, 'D': 5, 'C': 1, 'Q': 2, 'E': 4, 'G': 3, 'H': 2, 'I': 7, 'L': 13, 'K': 5, 'M': 1, 'F': 6, 'P': 2, 'S': 5, 'T': 1, 'W': 0, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 5.41%, 'R': 9.46%, 'N': 1.35%, 'D': 6.76%, 'C': 1.35%, 'Q': 2.7%, 'E': 5.41%, 'G': 4.05%, 'H': 2.7%, 'I': 9.46%, 'L': 17.57%, 'K': 6.76%, 'M': 1.35%, 'F': 8.11%, 'P': 2.7%, 'S': 6.76%, 'T': 1.35%, 'W': 0%, 'Y': 2.7%, 'V': 4.05%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, N, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8679.28 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	122.568	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.616	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.146	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.6	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.787	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.124	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.419, 0.149, 0.297 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.108	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Du Q, Hou X, Ge L, et al. Cationicity-enhanced analogues of the antimicrobial peptides, AcrAP1 and AcrAP2, from the venom of the scorpion, Androctonus crassicauda, display potent growth modulation effects on human cancer cell lines. Int J Biol Sci. 2014;10(10):1097-107. Published 2014. doi:10.7150/ijbs.9859

PMID: 25332684

5.2 Protein Sequence Databases

UniProt: A0A0A1I6E7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A0A1I6E7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	HG939518	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download