AMPDB_298 | M-myrmeciitoxin-Mp1

1 General Description

AMPDB ID: AMPDB_298

Protein Names: M-myrmeciitoxin-Mp1 (M-MIITX-Mp1) (Allergen Myr p I) (Major allergen Myr p 1) (Pilosulin-1) (allergen Myr p 1) [Cleaved into: M-myrmeciitoxin-Mp1a (M-MIITX-Mp1a) (M-myrmeciitoxin-Mp1b) (M-MIITX-Mp1b) (Pilosulin-1 57->112) (Myr p 1 57->112) (Myr p 1 57->112 (Ile5)) ([Ile-5]pilosulin-1); M-myrmeciitoxin-Mp1c (M-MIITX-Mp1c) (Pilosulin-1 65->112) (Myr p 1 65->112); M-myrmeciitoxin-Mp1d (M-MIITX-Mp1d) (Pilosulin-1 68->112) (Myr p 1 68->112); M-myrmeciitoxin-Mp1e (M-MIITX-Mp1e) (Pilosulin-1 71->112) (Myr p 1 71->112); U1-myrmeciitoxin-Mp1f (U1-MIITX-Mp1f) (Pilosulin-1 86->112) (Myr p 1 86->112)]

Protein Family: Formicidae venom precursor-01 superfamily; Ant pilosulin family

Gene Name: Nil

Source Organism: Myrmecia pilosula (Jack jumper ant) (Australian jumper ant)

Protein Length: 112 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKLSCLLLTLTIIFVLTIVHAPNVEAKDLADPESEAVGFADAFGEADAVGEADPNAGLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ

FASTA format

Counts of Amino Acids

'A': 16, 'R': 3, 'N': 2, 'D': 5, 'C': 1, 'Q': 4, 'E': 9, 'G': 8, 'H': 1, 'I': 6, 'L': 12, 'K': 10, 'M': 4, 'F': 4, 'P': 8, 'S': 4, 'T': 3, 'W': 0, 'Y': 0, 'V': 12

Frequencies of Amino Acids

'A': 14.29%, 'R': 2.68%, 'N': 1.79%, 'D': 4.46%, 'C': 0.89%, 'Q': 3.57%, 'E': 8.04%, 'G': 7.14%, 'H': 0.89%, 'I': 5.36%, 'L': 10.71%, 'K': 8.93%, 'M': 3.57%, 'F': 3.57%, 'P': 7.14%, 'S': 3.57%, 'T': 2.68%, 'W': 0%, 'Y': 0%, 'V': 10.71%

Missing Amino Acid(s)

W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, H

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11849 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	108.036	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.735	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.233	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.916	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.887	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.958	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.304, 0.196, 0.366 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.036	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Donovan GR, Baldo BA, Sutherland S, et al. Molecular cloning and characterization of a major allergen (Myr p I) from the venom of the Australian jumper ant, Myrmecia pilosula. Biochim Biophys Acta. 1993;1171(3):272-80. Published 1993 Jan 23. doi:10.1016/0167-4781(93)90065-l

PMID: 7678752

Citation 2: Donovan GR, Street MD, Tetaz T, et al. Expression of jumper ant (Myrmecia pilosula) venom allergens: post-translational processing of allergen gene products. Biochem Mol Biol Int. 1996;39(5):877-85. Published 1996 Aug. doi:10.1080/15216549600201022

PMID: 8866004

Citation 3: Davies NW, Wiese MD, Brown SG, et al. Characterisation of major peptides in 'jack jumper' ant venom by mass spectrometry. Toxicon. 2004;43(2):173-83. Published 2004 Feb. doi:10.1016/j.toxicon.2003.11.021

PMID: 15019477

Citation 4: Street MD, Donovan GR, Baldo BA, et al. Molecular cloning and characterization of the major allergen Myr p II from the venom of the jumper ant Myrmecia pilosula: Myr p I and Myr p II share a common protein leader sequence. Biochim Biophys Acta. 1996;1305(1-2):87-97. Published 1996 Feb 7. doi:10.1016/0167-4781(95)00197-2

PMID: 8605256

Citation 5: Wu QX, King MA, Donovan GR, et al. Cytotoxicity of pilosulin 1, a peptide from the venom of the jumper ant Myrmecia pilosula. Biochim Biophys Acta. 1998;1425(1):74-80. Published 1998 Sep 16. doi:10.1016/s0304-4165(98)00052-x

PMID: 9813247

Citation 6: King MA, Wu QX, Donovan GR, et al. Flow cytometric analysis of cell killing by the jumper ant venom peptide pilosulin 1. Cytometry. 1998;32(4):268-73. Published 1998 Aug 1. doi:10.1002/(sici)1097-0320(19980801)32:4<268::aid-cyto2>3.0.co;2-e

PMID: 9701394

Citation 7: Zelezetsky I, Pag U, Antcheva N, et al. Identification and optimization of an antimicrobial peptide from the ant venom toxin pilosulin. Arch Biochem Biophys. 2005;434(2):358-64. Published 2005 Feb 15. doi:10.1016/j.abb.2004.11.006

PMID: 15639237

Citation 8: Donovan GR, Street MD, Baldo BA, et al. Identification of an IgE-binding determinant of the major allergen Myr p I from the venom of the Australian jumper ant Myrmecia pilosula. Biochim Biophys Acta. 1994;1204(1):48-52. Published 1994 Jan 11. doi:10.1016/0167-4838(94)90031-0

PMID: 7508264

Citation 9: Touchard A, Aili SR, Fox EG, et al. The Biochemical Toxin Arsenal from Ant Venoms. Toxins (Basel). 2016;8(1). Published 2016 Jan 20. doi:10.3390/toxins8010030

PMID: 26805882

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q07932

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X70256	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download