AMPDB_2975 | Brevinin-1PLb

PEPTIDE SUMMARY

Brevinin-1PLb

1 General Description

AMPDB ID: AMPDB_2975

Protein Names: Brevinin-1PLb

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: Nil

Source Organism: Lithobates palustris (Pickerel frog) (Rana palustris)

Protein Length: 70 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTTKKSMLLLFFLGTINLSLCEEERNAEEERRDEPDEMNVEVEKRFLPLIAGLAANFLPKIFCAITKKC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 4, 'N': 4, 'D': 2, 'C': 3, 'Q': 0, 'E': 10, 'G': 2, 'H': 0, 'I': 4, 'L': 10, 'K': 6, 'M': 3, 'F': 6, 'P': 3, 'S': 2, 'T': 4, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 7.14%, 'R': 5.71%, 'N': 5.71%, 'D': 2.86%, 'C': 4.29%, 'Q': 0%, 'E': 14.29%, 'G': 2.86%, 'H': 0%, 'I': 5.71%, 'L': 14.29%, 'K': 8.57%, 'M': 4.29%, 'F': 8.57%, 'P': 4.29%, 'S': 2.86%, 'T': 5.71%, 'W': 0%, 'Y': 0%, 'V': 2.86%

Missing Amino Acid(s)

H, Q, W, Y

Most Occurring Amino Acid(s)

E, L

Less Occurring Amino Acid(s)

D, G, S, V

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8097.53 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	93.429	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.693	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.057	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.579	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.786	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.171	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.314, 0.157, 0.4 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.086	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhou M, Wang L, Owens DE, et al. Rapid identification of precursor cDNAs encoding five structural classes of antimicrobial peptides from pickerel frog (Rana palustris) skin secretion by single step 'shotgun' cloning. Peptides. 2007;28(8):1605-10. Published 2007 Aug. doi:10.1016/j.peptides.2007.07.019

PMID: 17698247

Citation 2: Basir YJ, Knoop FC, Dulka J, et al. Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris. Biochim Biophys Acta. 2000;1543(1):95-105. Published 2000 Nov 30. doi:10.1016/s0167-4838(00)00191-6

PMID: 11087945

5.2 Protein Sequence Databases

UniProt: A7WNV3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A7WNV3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AM745087	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012520, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download