AMPDB_2974 | Ixosin-B

PEPTIDE SUMMARY

Ixosin-B

1 General Description

AMPDB ID: AMPDB_2974

Protein Names: Ixosin-B

Protein Family: Nil

Gene Name: Nil

Source Organism: Ixodes sinensis (Hard tick)

Protein Length: 89 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MASGWTHRLLLLAAVVTLGATPIAAASMEYLVTAPGYLTPNADIKITAVVTNPSSAGQLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 6, 'N': 2, 'D': 3, 'C': 0, 'Q': 3, 'E': 2, 'G': 7, 'H': 2, 'I': 4, 'L': 9, 'K': 3, 'M': 2, 'F': 0, 'P': 5, 'S': 9, 'T': 8, 'W': 3, 'Y': 3, 'V': 7

Frequencies of Amino Acids

'A': 12.36%, 'R': 6.74%, 'N': 2.25%, 'D': 3.37%, 'C': 0%, 'Q': 3.37%, 'E': 2.25%, 'G': 7.87%, 'H': 2.25%, 'I': 4.49%, 'L': 10.11%, 'K': 3.37%, 'M': 2.25%, 'F': 0%, 'P': 5.62%, 'S': 10.11%, 'T': 8.99%, 'W': 3.37%, 'Y': 3.37%, 'V': 7.87%

Missing Amino Acid(s)

C, F

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, H, M, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9564.95 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.135	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.365	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.057	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.492	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.438	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.181	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.292, 0.258, 0.27 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.067	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	20970, 20970	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Liu Z, Liu H, Liu X, et al. Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis. Comp Biochem Physiol B Biochem Mol Biol. 2008;149(4):557-61. Published 2008 Apr. doi:10.1016/j.cbpb.2007.10.002

PMID: 18295522

5.2 Protein Sequence Databases

UniProt: A7UDM9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A7UDM9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU047746	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download