AMPDB_297 | Regenerating islet-derived protein 3-alpha

1 General Description

AMPDB ID: AMPDB_297

Protein Names: Regenerating islet-derived protein 3-alpha (REG-3-alpha) (Hepatointestinal pancreatic protein) (HIP PAP) (Human proislet peptide) (Pancreatitis-associated protein 1) (Regenerating islet-derived protein III-alpha) (Reg III-alpha) [Cleaved into: Regenerating islet-derived protein 3-alpha 16.5 kDa form; Regenerating islet-derived protein 3-alpha 15 kDa form]

Protein Family: Nil

Gene Name: REG3A HIP PAP PAP1

Source Organism: Homo sapiens (Human)

Protein Length: 175 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

FASTA format

Counts of Amino Acids

'A': 10, 'R': 8, 'N': 7, 'D': 6, 'C': 7, 'Q': 5, 'E': 8, 'G': 12, 'H': 3, 'I': 4, 'L': 18, 'K': 7, 'M': 5, 'F': 5, 'P': 13, 'S': 27, 'T': 6, 'W': 7, 'Y': 7, 'V': 10

Frequencies of Amino Acids

'A': 5.71%, 'R': 4.57%, 'N': 4%, 'D': 3.43%, 'C': 4%, 'Q': 2.86%, 'E': 4.57%, 'G': 6.86%, 'H': 1.71%, 'I': 2.29%, 'L': 10.29%, 'K': 4%, 'M': 2.86%, 'F': 2.86%, 'P': 7.43%, 'S': 15.43%, 'T': 3.43%, 'W': 4%, 'Y': 4%, 'V': 5.71%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19395 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.314	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.931	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.247	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.57	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.73	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.846	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.291, 0.337, 0.234 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.109	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	48930, 49305	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Lectin, Signal peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Itoh T, Teraoka H, Teraoka H. Cloning and tissue-specific expression of cDNAs for the human and mouse homologues of rat pancreatitis-associated protein (PAP). Biochim Biophys Acta. 1993;1172(1-2):184-6. Published 1993 Feb 20. doi:10.1016/0167-4781(93)90290-t

PMID: 7679928

Citation 2: Orelle B, Keim V, Masciotra L, et al. Human pancreatitis-associated protein. Messenger RNA cloning and expression in pancreatic diseases. J Clin Invest. 1992;90(6):2284-91. Published 1992 Dec. doi:10.1172/JCI116115

PMID: 1469087

Citation 3: Lasserre C, Christa L, Simon MT, et al. A novel gene (HIP) activated in human primary liver cancer. Cancer Res. 1992;52(18):5089-95. Published 1992 Sep 15. doi:

PMID: 1325291

Citation 4: Dusetti NJ, Frigerio JM, Fox MF, et al. Molecular cloning, genomic organization, and chromosomal localization of the human pancreatitis-associated protein (PAP) gene. Genomics. 1994;19(1):108-14. Published 1994 Jan 1. doi:10.1006/geno.1994.1019

PMID: 8188210

Citation 5: Lasserre C, Simon MT, Ishikawa H, et al. Structural organization and chromosomal localization of a human gene (HIP/PAP) encoding a C-type lectin overexpressed in primary liver cancer. Eur J Biochem. 1994;224(1):29-38. Published 1994 Aug 15. doi:10.1111/j.1432-1033.1994.tb19991.x

PMID: 8076648

Citation 6: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 7: Medveczky P, Szmola R, Sahin-TÃ³th M, et al. Proteolytic activation of human pancreatitis-associated protein is required for peptidoglycan binding and bacterial aggregation. Biochem J. 2009;420(2):335-43. Published 2009 May 13. doi:10.1042/BJ20090005

PMID: 19254208

Citation 8: Cash HL, Whitham CV, Behrendt CL, et al. Symbiotic bacteria direct expression of an intestinal bactericidal lectin. Science. 2006;313(5790):1126-30. Published 2006 Aug 25. doi:10.1126/science.1127119

PMID: 16931762

Citation 9: Lai Y, Li D, Li C, et al. The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury. Immunity. 2012;37(1):74-84. Published 2012 Jul 27. doi:10.1016/j.immuni.2012.04.010

PMID: 22727489

Citation 10: Lehotzky RE, Partch CL, Mukherjee S, et al. Molecular basis for peptidoglycan recognition by a bactericidal lectin. Proc Natl Acad Sci U S A. 2010;107(17):7722-7. Published 2010 Apr 27. doi:10.1073/pnas.0909449107

PMID: 20382864

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q06141

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	D13510	GenBank \|\| EMBL
2.	M84337	GenBank \|\| EMBL
3.	S51768	GenBank \|\| EMBL
4.	X68641	GenBank \|\| EMBL
5.	L15533	GenBank \|\| EMBL
6.	BC036776	GenBank \|\| EMBL

CCDS: CCDS1965.1

5.5 Protein-Protein Interaction Databases

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: Not found

PROSITE: PS00615, PS50041

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000162300

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000162300

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download