AMPDB_2966 | Defensin-1

PEPTIDE SUMMARY

Defensin-1

1 General Description

AMPDB ID: AMPDB_2966

Protein Names: Defensin-1

Protein Family: DEFL family

Gene Name: Def1

Source Organism: Pinus sylvestris (Scotch pine)

Protein Length: 83 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAGKGVGSRLSTLFLLVLLVITIGMMQVQVAEGRMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 4, 'N': 4, 'D': 1, 'C': 8, 'Q': 2, 'E': 2, 'G': 10, 'H': 1, 'I': 2, 'L': 6, 'K': 7, 'M': 4, 'F': 4, 'P': 4, 'S': 4, 'T': 6, 'W': 0, 'Y': 3, 'V': 8

Frequencies of Amino Acids

'A': 3.61%, 'R': 4.82%, 'N': 4.82%, 'D': 1.2%, 'C': 9.64%, 'Q': 2.41%, 'E': 2.41%, 'G': 12.05%, 'H': 1.2%, 'I': 2.41%, 'L': 7.23%, 'K': 8.43%, 'M': 4.82%, 'F': 4.82%, 'P': 4.82%, 'S': 4.82%, 'T': 7.23%, 'W': 0%, 'Y': 3.61%, 'V': 9.64%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9016.74 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	69.157	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	10.359	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.095	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.482	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.206	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.592	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.277, 0.265, 0.181 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.084	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4970	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), F.oxysporum, F.solani (Gram-positive), H.annosum

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kovaleva V, Kiyamova R, Cramer R, et al. Purification and molecular cloning of antimicrobial peptides from Scots pine seedlings. Peptides. 2009;30(12):2136-43. Published 2009 Dec. doi:10.1016/j.peptides.2009.08.007

PMID: 19683554

5.2 Protein Sequence Databases

UniProt: A4L7R7

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: A4L7R7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EF455616	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008176, IPR003614, IPR036574

PANTHER: Not found

PROSITE: PS00940

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download