AMPDB_296 | Defensin-6
PEPTIDE SUMMARY
Defensin-6
1 General Description
AMPDB ID: AMPDB_296
Protein Names: Defensin-6 (Defensin; alpha 6)
Protein Family: Alpha-defensin family
Gene Name: DEFA6 DEF6
Source Organism: Homo sapiens (Human)
Protein Length: 100 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 15, 'R': 7, 'N': 2, 'D': 6, 'C': 6, 'Q': 6, 'E': 6, 'G': 4, 'H': 2, 'I': 2, 'L': 10, 'K': 2, 'M': 2, 'F': 4, 'P': 2, 'S': 8, 'T': 8, 'W': 0, 'Y': 4, 'V': 4
Frequencies of Amino Acids
'A': 15%, 'R': 7%, 'N': 2%, 'D': 6%, 'C': 6%, 'Q': 6%, 'E': 6%, 'G': 4%, 'H': 2%, 'I': 2%, 'L': 10%, 'K': 2%, 'M': 2%, 'F': 4%, 'P': 2%, 'S': 8%, 'T': 8%, 'W': 0%, 'Y': 4%, 'V': 4%
Missing Amino Acid(s)
W
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
H, I, K, M, N, P
Hydrophobic Amino Acid(s) Count
43
Hydrophilic Amino Acid(s) Count
57
Basic Amino Acid(s) Count
12
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 10975.3 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 73.4 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 55.338 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.169 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.573 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 5.035 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -3.183 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.24, 0.16, 0.33 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.08 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 5960, 6335 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.adolescentis (Gram-positive), B.breve (Gram-positive), B.longum (Gram-positive), C.albicans, E.coli (Gram-negative), L.acidophilus (Gram-positive), L.monocytogenes (Gram-positive), S.thermophilus (Gram-positive), S.typhimurium, Y.enterocolitica (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-biofilm, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Jones DE, Bevins CL, Bevins CL. Defensin-6 mRNA in human Paneth cells: implications for antimicrobial peptides in host defense of the human bowel. FEBS Lett. 1993;315(2):187-92. Published 1993 Jan 4. doi:10.1016/0014-5793(93)81160-2
PMID: 8417977
Citation 2: Mallow EB, Harris A, Salzman N, et al. Human enteric defensins. Gene structure and developmental expression. J Biol Chem. 1996;271(8):4038-45. Published 1996 Feb 23. doi:10.1074/jbc.271.8.4038
PMID: 8626737
Citation 3: Nusbaum C, Mikkelsen TS, Zody MC, et al. DNA sequence and analysis of human chromosome 8. Nature. 2006;439(7074):331-5. Published 2006 Jan 19. doi:10.1038/nature04406
PMID: 16421571
Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504
PMID: 15489334
Citation 5: Chairatana P, Chu H, Castillo PA, et al. Proteolysis Triggers Self-Assembly and Unmasks Innate Immune Function of a Human α-Defensin Peptide. Chem Sci. 2016;7(3):1738-1752. Published 2016 Mar 1. doi:10.1039/C5SC04194E
PMID: 27076903
Citation 6: Ericksen B, Wu Z, Lu W, et al. Antibacterial activity and specificity of the six human {alpha}-defensins. Antimicrob Agents Chemother. 2005;49(1):269-75. Published 2005 Jan. doi:10.1128/AAC.49.1.269-275.2005
PMID: 15616305
Citation 7: Chairatana P, Nolan EM, Nolan EM. Molecular basis for self-assembly of a human host-defense peptide that entraps bacterial pathogens. J Am Chem Soc. 2014;136(38):13267-76. Published 2014 Sep 24. doi:10.1021/ja5057906
PMID: 25158166
Citation 8: Schroeder BO, Ehmann D, Precht JC, et al. Paneth cell α-defensin 6 (HD-6) is an antimicrobial peptide. Mucosal Immunol. 2015;8(3):661-71. Published 2015 May. doi:10.1038/mi.2014.100
PMID: 25354318
Citation 9: Chairatana P, Chiang IL, Nolan EM, et al. Human α-Defensin 6 Self-Assembly Prevents Adhesion and Suppresses Virulence Traits of Candida albicans. Biochemistry. 2017;56(8):1033-1041. Published 2017 Feb 28. doi:10.1021/acs.biochem.6b01111
PMID: 28026958
Citation 10: Ehmann D, Wendler J, Koeninger L, et al. Paneth cell α-defensins HD-5 and HD-6 display differential degradation into active antimicrobial fragments. Proc Natl Acad Sci U S A. 2019;116(9):3746-3751. Published 2019 Feb 26. doi:10.1073/pnas.1817376116
PMID: 30808760
Citation 11: Szyk A, Wu Z, Tucker K, et al. Crystal structures of human alpha-defensins HNP4, HD5, and HD6. Protein Sci. 2006;15(12):2749-60. Published 2006 Dec. doi:10.1110/ps.062336606
PMID: 17088326
Citation 12: Chu H, Pazgier M, Jung G, et al. Human α-defensin 6 promotes mucosal innate immunity through self-assembled peptide nanonets. Science. 2012;337(6093):477-81. Published 2012 Jul 27. doi:10.1126/science.1218831
PMID: 22722251
5.2 Protein Sequence Databases
UniProt: Q01524
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: Q01524
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. M98331 GenBank || EMBL
2. U33317 GenBank || EMBL
3. AF200455 GenBank || EMBL
4. CH471153 GenBank || EMBL
5. BC069667 GenBank || EMBL
6. BC069710 GenBank || EMBL
7. BC069728 GenBank || EMBL
8. BC069769 GenBank || EMBL
9. BC093951 GenBank || EMBL
10. BC093953 GenBank || EMBL
CCDS: CCDS5960.1
RefSeq: NP_001917.1
5.5 Protein-Protein Interaction Databases
STRING: 9606.ENSP00000297436
IntAct: Q01524
MINT: Not found
DIP: Not found
BioGRID: 108035
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR016327, IPR006081, IPR002366, IPR006080
PANTHER: PTHR11876
PROSITE: PS00269
5.8 Genome Annotation Databases
Ensembl: ENSGT00940000153268
KEGG: hsa:1671
5.9 Phylogenomic Databases
GeneTree: ENSGT00940000153268
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Q01524




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India