AMPDB_292 | Antileukoproteinase

1 General Description

AMPDB ID: AMPDB_292

Protein Names: Antileukoproteinase (ALP) (Secretory leukocyte protease inhibitor)

Protein Family: Nil

Gene Name: Slpi

Source Organism: Mus musculus (Mouse)

Protein Length: 131 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM

FASTA format

Counts of Amino Acids

'A': 8, 'R': 7, 'N': 4, 'D': 5, 'C': 17, 'Q': 7, 'E': 4, 'G': 12, 'H': 0, 'I': 5, 'L': 10, 'K': 15, 'M': 4, 'F': 1, 'P': 14, 'S': 2, 'T': 4, 'W': 3, 'Y': 1, 'V': 8

Frequencies of Amino Acids

'A': 6.11%, 'R': 5.34%, 'N': 3.05%, 'D': 3.82%, 'C': 12.98%, 'Q': 5.34%, 'E': 3.05%, 'G': 9.16%, 'H': 0%, 'I': 3.82%, 'L': 7.63%, 'K': 11.45%, 'M': 3.05%, 'F': 0.76%, 'P': 10.69%, 'S': 1.53%, 'T': 3.05%, 'W': 2.29%, 'Y': 0.76%, 'V': 6.11%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14308.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.473	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.141	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.261	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.778	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.892	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	11.948	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.214, 0.244, 0.198 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.038	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	17990, 18990	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

L.major, M.tuberculosis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-parasitic, Anti-tuberculosis, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

Protease inhibitor, Serine protease inhibitor

4.5 Other Biological Activity

Wound healing, Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Jin FY, Nathan C, Radzioch D, et al. Secretory leukocyte protease inhibitor: a macrophage product induced by and antagonistic to bacterial lipopolysaccharide. Cell. 1997;88(3):417-26. Published 1997 Feb 7. doi:10.1016/s0092-8674(00)81880-2

PMID: 9039268

Citation 2: Zitnik RJ, Zhang J, Kashem MA, et al. The cloning and characterization of a murine secretory leukocyte protease inhibitor cDNA. Biochem Biophys Res Commun. 1997;232(3):687-97. Published 1997 Mar 27. doi:10.1006/bbrc.1997.6358

PMID: 9126337

Citation 3: Abe T, Tominaga Y, Kikuchi T, et al. Bacterial pneumonia causes augmented expression of the secretory leukoprotease inhibitor gene in the murine lung. Am J Respir Crit Care Med. 1997;156(4 Pt 1):1235-40. Published 1997 Oct. doi:10.1164/ajrccm.156.4.9701075

PMID: 9351627

Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 5: Ashcroft GS, Lei K, Jin W, et al. Secretory leukocyte protease inhibitor mediates non-redundant functions necessary for normal wound healing. Nat Med. 2000;6(10):1147-53. Published 2000 Oct. doi:10.1038/80489

PMID: 11017147

Citation 6: Zhu J, Nathan C, Jin W, et al. Conversion of proepithelin to epithelins: roles of SLPI and elastase in host defense and wound repair. Cell. 2002;111(6):867-78. Published 2002 Dec 13. doi:10.1016/s0092-8674(02)01141-8

PMID: 12526812

Citation 7: Nakamura A, Mori Y, Hagiwara K, et al. Increased susceptibility to LPS-induced endotoxin shock in secretory leukoprotease inhibitor (SLPI)-deficient mice. J Exp Med. 2003;197(5):669-74. Published 2003 Mar 3. doi:10.1084/jem.20021824

PMID: 12615907

Citation 8: Nishimura J, Saiga H, Sato S, et al. Potent antimycobacterial activity of mouse secretory leukocyte protease inhibitor. J Immunol. 2008;180(6):4032-9. Published 2008 Mar 15. doi:10.4049/jimmunol.180.6.4032

PMID: 18322212

Citation 9: McCartney-Francis N, Jin W, Belkaid Y, et al. Aberrant host defense against Leishmania major in the absence of SLPI. J Leukoc Biol. 2014;96(5):917-29. Published 2014 Nov. doi:10.1189/jlb.4A0612-295RR

PMID: 25030421

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P97430

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U73004	GenBank \|\| EMBL
2.	U88093	GenBank \|\| EMBL
3.	U94341	GenBank \|\| EMBL
4.	BC028509	GenBank \|\| EMBL

CCDS: CCDS17033.1

RefSeq: NP_035544.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036645, IPR008197

PANTHER: Not found

PROSITE: PS51390

5.8 Genome Annotation Databases

Ensembl: ENSGT00730000111217

5.9 Phylogenomic Databases

GeneTree: ENSGT00730000111217

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download