AMPDB_291 | BPI fold-containing family A member 1

1 General Description

AMPDB ID: AMPDB_291

Protein Names: BPI fold-containing family A member 1 (Palate lung and nasal epithelium clone protein)

Protein Family: BPI LBP Plunc superfamily; Plunc family

Gene Name: Bpifa1 Plunc Splunc1

Source Organism: Mus musculus (Mouse)

Protein Length: 278 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MFLVGSLVVLCGLLAHSTAQLAGLPLPLGQGPPLPLNQGPPLPLNQGQLLPLAQGLPLAVSPALPSNPTDLLAGKFTDALSGGLLSGGLLGILENIPLLDVIKSGGGNSNGLVGGLLGKLTSSVPLLNNILDIKITDPQLLELGLVQSPDGHRLYVTIPLGLTLNVNMPVVGSLLQLAVKLNITAEVLAVKDNQGRIHLVLGDCTHSPGSLKISLLNGVTPVQSFLDNLTGILTKVLPELIQGKVCPLVNGILSGLDVTLVHNIAELLIHGLQFVIKV

FASTA format

Counts of Amino Acids

'A': 12, 'R': 2, 'N': 16, 'D': 10, 'C': 3, 'Q': 13, 'E': 5, 'G': 34, 'H': 6, 'I': 16, 'L': 66, 'K': 10, 'M': 2, 'F': 4, 'P': 23, 'S': 17, 'T': 13, 'W': 0, 'Y': 1, 'V': 25

Frequencies of Amino Acids

'A': 4.32%, 'R': 0.72%, 'N': 5.76%, 'D': 3.6%, 'C': 1.08%, 'Q': 4.68%, 'E': 1.8%, 'G': 12.23%, 'H': 2.16%, 'I': 5.76%, 'L': 23.74%, 'K': 3.6%, 'M': 0.72%, 'F': 1.44%, 'P': 8.27%, 'S': 6.12%, 'T': 4.68%, 'W': 0%, 'Y': 0.36%, 'V': 8.99%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

182

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	28625 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	145.432	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.304	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.634	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.586	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.502	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.633	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.403, 0.324, 0.306 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.018	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1615	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

K.pneumoniae (Gram-negative), P.aeruginosa (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-biofilm, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Proteolytic, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Weston WM, LeClair EE, Trzyna W, et al. Differential display identification of plunc, a novel gene expressed in embryonic palate, nasal epithelium, and adult lung. J Biol Chem. 1999;274(19):13698-703. Published 1999 May 7. doi:10.1074/jbc.274.19.13698

PMID: 10224143

Citation 2: LeClair EE, Nguyen L, Bingle L, et al. Genomic organization of the mouse plunc gene and expression in the developing airways and thymus. Biochem Biophys Res Commun. 2001;284(3):792-7. Published 2001 Jun 15. doi:10.1006/bbrc.2001.5024

PMID: 11396972

Citation 3: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 4: Liu Y, Bartlett JA, Di ME, et al. SPLUNC1/BPIFA1 contributes to pulmonary host defense against Klebsiella pneumoniae respiratory infection. Am J Pathol. 2013;182(5):1519-31. Published 2013 May. doi:10.1016/j.ajpath.2013.01.050

PMID: 23499554

Citation 5: Little MS, Redinbo MR, Redinbo MR. Crystal structure of the mouse innate immunity factor bacterial permeability-increasing family member A1. Acta Crystallogr F Struct Biol Commun. 2018;74(Pt 5):268-276. Published 2018 May 1. doi:10.1107/S2053230X18004600

PMID: 29717993

5.2 Protein Sequence Databases

5.3 3D Structure Databases