AMPDB_289 | Defensin-A

1 General Description

AMPDB ID: AMPDB_289

Protein Names: Defensin-A (AaDef)

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: DEFA AAEL003841

Source Organism: Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Protein Length: 98 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKSITVICFLALCTVAITSAYPQEPVLADEARPFANSLFDELPEETYQAAVENFRLKRATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRN

FASTA format

Counts of Amino Acids

'A': 13, 'R': 6, 'N': 5, 'D': 4, 'C': 8, 'Q': 2, 'E': 6, 'G': 6, 'H': 1, 'I': 4, 'L': 8, 'K': 4, 'M': 1, 'F': 5, 'P': 4, 'S': 6, 'T': 5, 'W': 0, 'Y': 3, 'V': 7

Frequencies of Amino Acids

'A': 13.27%, 'R': 6.12%, 'N': 5.1%, 'D': 4.08%, 'C': 8.16%, 'Q': 2.04%, 'E': 6.12%, 'G': 6.12%, 'H': 1.02%, 'I': 4.08%, 'L': 8.16%, 'K': 4.08%, 'M': 1.02%, 'F': 5.1%, 'P': 4.08%, 'S': 6.12%, 'T': 5.1%, 'W': 0%, 'Y': 3.06%, 'V': 7.14%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10583.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.735	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.759	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.11	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.608	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.98	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.398	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.276, 0.214, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4970	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.cloacae (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Cho WL, Fu YC, Chen CC, et al. Cloning and characterization of cDNAs encoding the antibacterial peptide, defensin A, from the mosquito, Aedes aegypti. Insect Biochem Mol Biol. 1996;26(4):395-402. Published 1996 Apr. doi:10.1016/0965-1748(95)00108-5

PMID: 8814787

Citation 2: Lowenberger CA, Smartt CT, Bulet P, et al. Insect immunity: molecular cloning, expression, and characterization of cDNAs and genomic DNA encoding three isoforms of insect defensin in Aedes aegypti. Insect Mol Biol. 1999;8(1):107-18. Published 1999 Feb. doi:10.1046/j.1365-2583.1999.810107.x

PMID: 9927179

Citation 3: Gao Y, Hernandez VP, Fallon AM, et al. Immunity proteins from mosquito cell lines include three defensin A isoforms from Aedes aegypti and a defensin D from Aedes albopictus. Insect Mol Biol. 1999;8(3):311-8. Published 1999 Aug. doi:10.1046/j.1365-2583.1999.83119.x

PMID: 10469248

Citation 4: Meredith JM, Munks RJ, Grail W, et al. A novel association between clustered NF-kappaB and C/EBP binding sites is required for immune regulation of mosquito Defensin genes. Insect Mol Biol. 2006;15(4):393-401. Published 2006 Aug. doi:10.1111/j.1365-2583.2006.00635.x

PMID: 16907826

Citation 5: Nene V, Wortman JR, Lawson D, et al. Genome sequence of Aedes aegypti, a major arbovirus vector. Science. 2007;316(5832):1718-23. Published 2007 Jun 22. doi:10.1126/science.1138878

PMID: 17510324

Citation 6: Lowenberger C, Bulet P, Charlet M, et al. Insect immunity: isolation of three novel inducible antibacterial defensins from the vector mosquito, Aedes aegypti. Insect Biochem Mol Biol. 1995;25(7):867-73. Published 1995 Jul. doi:10.1016/0965-1748(95)00043-u

PMID: 7633471

Citation 7: Chalk R, Albuquerque CM, Ham PJ, et al. Full sequence and characterization of two insect defensins: immune peptides from the mosquito Aedes aegypti. Proc Biol Sci. 1995;261(1361):217-21. Published 1995 Aug 22. doi:10.1098/rspb.1995.0139

PMID: 7568275

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P91793

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	S82860	GenBank \|\| EMBL
2.	S82861	GenBank \|\| EMBL
3.	S82862	GenBank \|\| EMBL
4.	S82863	GenBank \|\| EMBL
5.	AF156088	GenBank \|\| EMBL
6.	AF156089	GenBank \|\| EMBL
7.	AF095259	GenBank \|\| EMBL
8.	AF387487	GenBank \|\| EMBL
9.	AF392802	GenBank \|\| EMBL
10.	AF392803	GenBank \|\| EMBL
11.	AF392804	GenBank \|\| EMBL
12.	AY625500	GenBank \|\| EMBL
13.	AY625501	GenBank \|\| EMBL
14.	CH477283	GenBank \|\| EMBL
15.	CH477283	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

STRING: 7159.AAEL003841-PA

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download