AMPDB_286 | Lantibiotic lichenicidin VK21 A2

PEPTIDE SUMMARY

Lantibiotic lichenicidin VK21 A2

1 General Description

AMPDB ID: AMPDB_286

Protein Names: Lantibiotic lichenicidin VK21 A2 (LchA2)

Protein Family: Nil

Gene Name: lchA2

Source Organism: Bacillus licheniformis

Protein Length: 72 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTMKNSAAREAFKGANHPAGMVSEEELKALVGGNDVNPETTPATTSSWTCITAGVTVSASLCPTTKCTSRC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 2, 'N': 4, 'D': 1, 'C': 4, 'Q': 0, 'E': 5, 'G': 5, 'H': 1, 'I': 1, 'L': 3, 'K': 5, 'M': 3, 'F': 1, 'P': 4, 'S': 7, 'T': 11, 'W': 1, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 12.5%, 'R': 2.78%, 'N': 5.56%, 'D': 1.39%, 'C': 5.56%, 'Q': 0%, 'E': 6.94%, 'G': 6.94%, 'H': 1.39%, 'I': 1.39%, 'L': 4.17%, 'K': 6.94%, 'M': 4.17%, 'F': 1.39%, 'P': 5.56%, 'S': 9.72%, 'T': 15.28%, 'W': 1.39%, 'Y': 0%, 'V': 6.94%

Missing Amino Acid(s)

Q, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, H, I, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7448.45 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	54.306	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.572	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.246	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.618	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.933	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.849	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.153, 0.278, 0.278 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.028	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5750	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.amyloliquefaciens (Gram-positive), B.megaterium, B.pumilus (Gram-positive), B.subtilis (Gram-positive), E.coli (Gram-negative), M.luteus (Gram-negative), M.phlei (Gram-positive), M.smegmatis (Gram-positive), P.aeruginosa (Gram-negative), P.putida (Gram-negative), Rhodococcus sp. (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Shenkarev ZO, Finkina EI, Nurmukhamedova EK, et al. Isolation, structure elucidation, and synergistic antibacterial activity of a novel two-component lantibiotic lichenicidin from Bacillus licheniformis VK21. Biochemistry. 2010;49(30):6462-72. Published 2010 Aug 3. doi:10.1021/bi100871b

PMID: 20578714

5.2 Protein Sequence Databases

UniProt: P86476

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P86476

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	GU949560	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_003186379.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR027632

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download