AMPDB_285 | Lantibiotic lichenicidin VK21 A1
PEPTIDE SUMMARY
Lantibiotic lichenicidin VK21 A1
1 General Description
AMPDB ID: AMPDB_285
Protein Names: Lantibiotic lichenicidin VK21 A1 (LchA1)
Protein Family: Nil
Gene Name: lchA1
Source Organism: Bacillus licheniformis
Protein Length: 74 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGGTITLSTCAILSKPLGNNGYLCTVTKECMPSCN
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 1, 'N': 5, 'D': 0, 'C': 4, 'Q': 2, 'E': 7, 'G': 5, 'H': 2, 'I': 5, 'L': 7, 'K': 6, 'M': 4, 'F': 0, 'P': 4, 'S': 8, 'T': 6, 'W': 1, 'Y': 3, 'V': 1
Frequencies of Amino Acids
'A': 4.05%, 'R': 1.35%, 'N': 6.76%, 'D': 0%, 'C': 5.41%, 'Q': 2.7%, 'E': 9.46%, 'G': 6.76%, 'H': 2.7%, 'I': 6.76%, 'L': 9.46%, 'K': 8.11%, 'M': 5.41%, 'F': 0%, 'P': 5.41%, 'S': 10.81%, 'T': 8.11%, 'W': 1.35%, 'Y': 4.05%, 'V': 1.35%
Missing Amino Acid(s)
D, F
Most Occurring Amino Acid(s)
S
Less Occurring Amino Acid(s)
R, V, W
Hydrophobic Amino Acid(s) Count
30
Hydrophilic Amino Acid(s) Count
44
Basic Amino Acid(s) Count
7
Acidic Amino Acid(s) Count
9
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8208.45 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 71.216 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 78.595 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.416 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.548 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.289 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -0.06 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.23, 0.297, 0.284 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.054 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 9970, 10220 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.amyloliquefaciens (Gram-positive), B.megaterium, B.pumilus (Gram-positive), B.subtilis (Gram-positive), E.coli (Gram-negative), M.luteus (Gram-negative), M.phlei (Gram-positive), M.smegmatis (Gram-positive), P.aeruginosa (Gram-negative), P.putida (Gram-negative), Rhodococcus sp. (Gram-positive), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Shenkarev ZO, Finkina EI, Nurmukhamedova EK, et al. Isolation, structure elucidation, and synergistic antibacterial activity of a novel two-component lantibiotic lichenicidin from Bacillus licheniformis VK21. Biochemistry. 2010;49(30):6462-72. Published 2010 Aug 3. doi:10.1021/bi100871b
PMID: 20578714
5.2 Protein Sequence Databases
UniProt: P86475
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: P86475
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. GU949560 GenBank || EMBL
CCDS: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR029243
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India