AMPDB_284 | Defensin Lucifensin

1 General Description

AMPDB ID: AMPDB_284

Protein Names: Defensin Lucifensin (Sericasin)

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Lucilia sericata (Green bottle fly) (Phaenicia sericata)

Protein Length: 92 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKFFMVFAVTFCLALSFVSQSLALPADDEAHFVDGLEALKTIEPELHGRYKRATCDLLSGTGVKHSACAAHCLLRGNRGGYCNGRAICVCRN

FASTA format

Counts of Amino Acids

'A': 11, 'R': 6, 'N': 3, 'D': 4, 'C': 7, 'Q': 1, 'E': 4, 'G': 8, 'H': 4, 'I': 2, 'L': 11, 'K': 4, 'M': 2, 'F': 6, 'P': 2, 'S': 5, 'T': 4, 'W': 0, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 11.96%, 'R': 6.52%, 'N': 3.26%, 'D': 4.35%, 'C': 7.61%, 'Q': 1.09%, 'E': 4.35%, 'G': 8.7%, 'H': 4.35%, 'I': 2.17%, 'L': 11.96%, 'K': 4.35%, 'M': 2.17%, 'F': 6.52%, 'P': 2.17%, 'S': 5.43%, 'T': 4.35%, 'W': 0%, 'Y': 2.17%, 'V': 6.52%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

A, L

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9995.62 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.978	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.799	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.225	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.582	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.058	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.934	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.293, 0.196, 0.304 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.087	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

C.albicans, M.luteus (Gram-negative), S.aureus (Gram-positive), S.carnosus (Gram-positive), S.pneumoniae (Gram-positive), S.pyogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-MRSA, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Andersen AS, Sandvang D, Schnorr KM, et al. A novel approach to the antimicrobial activity of maggot debridement therapy. J Antimicrob Chemother. 2010;65(8):1646-54. Published 2010 Aug. doi:10.1093/jac/dkq165

PMID: 20542901

Citation 2: CerovskÃ½ V, ZdÃ¡rek J, FucÃk V, et al. Lucifensin, the long-sought antimicrobial factor of medicinal maggots of the blowfly Lucilia sericata. Cell Mol Life Sci. 2010;67(3):455-66. Published 2010 Feb. doi:10.1007/s00018-009-0194-0

PMID: 19921400

Citation 3: Schneider T, Kruse T, Wimmer R, et al. Plectasin, a fungal defensin, targets the bacterial cell wall precursor Lipid II. Science. 2010;328(5982):1168-72. Published 2010 May 28. doi:10.1126/science.1185723

PMID: 20508130

Citation 4: CeÅovskÃ½ V, SlaninovÃ¡ J, FuÄÃk V, et al. Lucifensin, a novel insect defensin of medicinal maggots: synthesis and structural study. Chembiochem. 2011;12(9):1352-61. Published 2011 Jun 14. doi:10.1002/cbic.201100066

PMID: 21560219

Citation 5: ValachovÃ¡ I, BohovÃ¡ J, PÃ¡loÅ¡ovÃ¡ Z, et al. Expression of lucifensin in Lucilia sericata medicinal maggots in infected environments. Cell Tissue Res. 2013;353(1):165-71. Published 2013 Jul. doi:10.1007/s00441-013-1626-6

PMID: 23624615

Citation 6: Valachova I, Prochazka E, Bohova J, et al. Antibacterial properties of lucifensin in Lucilia sericata maggots after septic injury. Asian Pac J Trop Biomed. 2014;4(5):358-61. Published 2014 May. doi:10.12980/APJTB.4.2014C1134

PMID: 25182719

Citation 7: Nygaard MK, Andersen AS, Kristensen HH, et al. The insect defensin lucifensin from Lucilia sericata. J Biomol NMR. 2012;52(3):277-82. Published 2012 Mar. doi:10.1007/s10858-012-9608-7

PMID: 22322867

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P86471

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	HM243535	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download