AMPDB_283 | Lysozyme

PEPTIDE SUMMARY

Lysozyme

1 General Description

AMPDB ID: AMPDB_283

Protein Names: Lysozyme (EC 3.2.1.17) (1;4-beta-N-acetylmuramidase) (Invertebrate-type lysozyme)

Protein Family: Glycosyl hydrolase 22 family; Type-I lysozyme subfamily

Gene Name: Nil

Source Organism: Meretrix lusoria (Hard clam) (Common Orient clam)

Protein Length: 122 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

FAGGIVSQRCLSCICKMESGCRNVGCKMDMGSLSCGYFQIKEAYWIDCGRPGSSWKSCAASSYCASLCVQNYMKRYAKWAGCPLRCEGFAREHNGGPRGCKKGSTIGYWNRLQKISGCHGVQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 8, 'N': 4, 'D': 2, 'C': 14, 'Q': 5, 'E': 4, 'G': 17, 'H': 2, 'I': 6, 'L': 5, 'K': 9, 'M': 4, 'F': 3, 'P': 3, 'S': 13, 'T': 1, 'W': 4, 'Y': 6, 'V': 4

Frequencies of Amino Acids

'A': 6.56%, 'R': 6.56%, 'N': 3.28%, 'D': 1.64%, 'C': 11.48%, 'Q': 4.1%, 'E': 3.28%, 'G': 13.93%, 'H': 1.64%, 'I': 4.92%, 'L': 4.1%, 'K': 7.38%, 'M': 3.28%, 'F': 2.46%, 'P': 2.46%, 'S': 10.66%, 'T': 0.82%, 'W': 3.28%, 'Y': 4.92%, 'V': 3.28%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13377.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	51.23	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	41.705	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.294	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.637	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.883	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.312	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.23, 0.303, 0.172 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.107	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	30940, 31815	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriolytic enzyme, Anti-gram-Positive

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kuwano Y, Yoneda K, Kawaguchi Y, et al. The complete amino acid sequence and enzymatic properties of an i-type lysozyme isolated from the common orient clam (Meretrix lusoria). Biosci Biotechnol Biochem. 2013;77(11):2269-77. Published 2013. doi:10.1271/bbb.130534

PMID: 24200802

Citation 2: Kuwano Y, Yoneda K, Kawaguchi Y, et al. The tertiary structure of an i-type lysozyme isolated from the common orient clam (Meretrix lusoria). Acta Crystallogr Sect F Struct Biol Cryst Commun. 2013;69(Pt 11):1202-6. Published 2013 Nov. doi:10.1107/S1744309113028170

PMID: 24192349

Citation 3: Leysen S, Van Herreweghe JM, Yoneda K, et al. The structure of the proteinaceous inhibitor PliI from Aeromonas hydrophila in complex with its target lysozyme. Acta Crystallogr D Biol Crystallogr. 2015;71(Pt 2):344-51. Published 2015 Feb. doi:10.1107/S1399004714025863

PMID: 25664745

5.2 Protein Sequence Databases

UniProt: P86383

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P86383

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008597, IPR023346

PANTHER: PTHR11195

PROSITE: PS51909

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: 3.2.1.17

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download