AMPDB_280 | Eumenine mastoparan-OD

PEPTIDE SUMMARY

Eumenine mastoparan-OD

1 General Description

AMPDB ID: AMPDB_280

Protein Names: Eumenine mastoparan-OD (EMP-OD) (Venom peptide 1) (OdVP1) (VP1)

Protein Family: MCD family; Mastoparan subfamily

Gene Name: VP1

Source Organism: Orancistrocerus drewseni (Solitary wasp)

Protein Length: 79 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKQTIVIVLLAAVAMMACLQMVAAEPLPEAAPAPSPLAEAEALASPIAEALANPEALASPEAGRILSFIKGLAEHLGKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 20, 'R': 1, 'N': 1, 'D': 0, 'C': 1, 'Q': 2, 'E': 8, 'G': 3, 'H': 1, 'I': 5, 'L': 11, 'K': 4, 'M': 4, 'F': 1, 'P': 8, 'S': 4, 'T': 1, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 25.32%, 'R': 1.27%, 'N': 1.27%, 'D': 0%, 'C': 1.27%, 'Q': 2.53%, 'E': 10.13%, 'G': 3.8%, 'H': 1.27%, 'I': 6.33%, 'L': 13.92%, 'K': 5.06%, 'M': 5.06%, 'F': 1.27%, 'P': 10.13%, 'S': 5.06%, 'T': 1.27%, 'W': 0%, 'Y': 0%, 'V': 5.06%

Missing Amino Acid(s)

D, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, F, H, N, R, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8028.58 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	118.987	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	59.854	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.637	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.603	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.6	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.96	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.266, 0.203, 0.544 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.013	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cinerea, C.albicans, E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Baek JH, Lee SH, Lee SH. Isolation and molecular cloning of venom peptides from Orancistrocerus drewseni (Hymenoptera: Eumenidae). Toxicon. 2010;55(4):711-8. Published 2010 Apr 1. doi:10.1016/j.toxicon.2009.10.023

PMID: 19857508

Citation 2: Murata K, Shinada T, Ohfune Y, et al. Novel mastoparan and protonectin analogs isolated from a solitary wasp, Orancistrocerus drewseni drewseni. Amino Acids. 2009;37(2):389-94. Published 2009 Jul. doi:10.1007/s00726-008-0166-y

PMID: 18695936

Citation 3: Konno K, Kazuma K, Nihei K, et al. Peptide Toxins in Solitary Wasp Venoms. Toxins (Basel). 2016;8(4):114. Published 2016 Apr 18. doi:10.3390/toxins8040114

PMID: 27096870

5.2 Protein Sequence Databases

UniProt: P86146

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P86146

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	GQ205580	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download