AMPDB_279 | Lantibiotic epilancin 15X

PEPTIDE SUMMARY

Lantibiotic epilancin 15X

1 General Description

AMPDB ID: AMPDB_279

Protein Names: Lantibiotic epilancin 15X

Protein Family: Type A lantibiotic family

Gene Name: elxA

Source Organism: Staphylococcus epidermidis

Protein Length: 55 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKKELFDLNLNKDIEAQKSDLNPQSASIVKTTIKASKKLCRGFTLTCGCHFTGKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 1, 'N': 3, 'D': 3, 'C': 3, 'Q': 2, 'E': 2, 'G': 3, 'H': 1, 'I': 3, 'L': 6, 'K': 10, 'M': 1, 'F': 3, 'P': 1, 'S': 4, 'T': 5, 'W': 0, 'Y': 0, 'V': 1

Frequencies of Amino Acids

'A': 5.45%, 'R': 1.82%, 'N': 5.45%, 'D': 5.45%, 'C': 5.45%, 'Q': 3.64%, 'E': 3.64%, 'G': 5.45%, 'H': 1.82%, 'I': 5.45%, 'L': 10.91%, 'K': 18.18%, 'M': 1.82%, 'F': 5.45%, 'P': 1.82%, 'S': 7.27%, 'T': 9.09%, 'W': 0%, 'Y': 0%, 'V': 1.82%

Missing Amino Acid(s)

W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M, P, R, V

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6130.21 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	74.546	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	29.58	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.5	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.753	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.218	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.905	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.236, 0.2, 0.218 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.055	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: VelÃ¡squez JE, Zhang X, van der Donk WA, et al. Biosynthesis of the antimicrobial peptide epilancin 15X and its N-terminal lactate. Chem Biol. 2011;18(7):857-67. Published 2011 Jul 29. doi:10.1016/j.chembiol.2011.05.007

PMID: 21802007

Citation 2: Ekkelenkamp MB, Hanssen M, Danny Hsu ST, et al. Isolation and structural characterization of epilancin 15X, a novel lantibiotic from a clinical strain of Staphylococcus epidermidis. FEBS Lett. 2005;579(9):1917-22. Published 2005 Mar 28. doi:10.1016/j.febslet.2005.01.083

PMID: 15792796

5.2 Protein Sequence Databases

UniProt: P86047

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P86047

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JQ979180	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012519

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download