AMPDB_274 | Lysozyme C

PEPTIDE SUMMARY

Lysozyme C

1 General Description

AMPDB ID: AMPDB_274

Protein Names: Lysozyme C (EC 3.2.1.17) (1;4-beta-N-acetylmuramidase C)

Protein Family: Glycosyl hydrolase 22 family

Gene Name: Nil

Source Organism: Bufo gargarizans andrewsi (Andrew`s toad) (Bufo andrewsi)

Protein Length: 146 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

SGKYISWEDSCSYLQLQKYERCELAKALKKGGLADFKGYSLENWICTAFHESGYNTASTNYNPPDKSTDYGIFQINSRWWCNDYKTPRSKNTCNIDCKVLLGDDISPAIKCAKRVVSDPNGMGAWVAWKKYCKGKNLSQWTQGCKL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 4, 'N': 10, 'D': 9, 'C': 9, 'Q': 5, 'E': 5, 'G': 11, 'H': 1, 'I': 7, 'L': 10, 'K': 17, 'M': 1, 'F': 3, 'P': 5, 'S': 13, 'T': 7, 'W': 7, 'Y': 9, 'V': 4

Frequencies of Amino Acids

'A': 6.16%, 'R': 2.74%, 'N': 6.85%, 'D': 6.16%, 'C': 6.16%, 'Q': 3.42%, 'E': 3.42%, 'G': 7.53%, 'H': 0.68%, 'I': 4.79%, 'L': 6.85%, 'K': 11.64%, 'M': 0.68%, 'F': 2.05%, 'P': 3.42%, 'S': 8.9%, 'T': 4.79%, 'W': 4.79%, 'Y': 6.16%, 'V': 2.74%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16607.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	59.521	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.471	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.681	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.704	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.769	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.531	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.274, 0.267, 0.171 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.13	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	51910, 52410	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriolytic enzyme, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhao Y, Jin Y, Lee WH, et al. Purification of a lysozyme from skin secretions of Bufo andrewsi. Comp Biochem Physiol C Toxicol Pharmacol. 2006;142(1-2):46-52. Published 2006 Jan-Feb. doi:10.1016/j.cbpc.2005.10.001

PMID: 16309969

5.2 Protein Sequence Databases

UniProt: P85045

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P85045

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001916, IPR019799, IPR000974, IPR023346, IPR030056

PANTHER: PTHR11407, PTHR11407:SF28

PROSITE: PS00128, PS51348

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download