AMPDB_272 | Beta-defensin 1

PEPTIDE SUMMARY

Beta-defensin 1

1 General Description

AMPDB ID: AMPDB_272

Protein Names: Beta-defensin 1 (BD-1) (Defensin; beta 1) (cBD-1)

Protein Family: Beta-defensin family

Gene Name: DEFB1

Source Organism: Chinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera)

Protein Length: 67 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRIHYLLFAVLFLFLMPVPGEGGIINTIQRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCRTRK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 10, 'N': 1, 'D': 0, 'C': 6, 'Q': 2, 'E': 2, 'G': 7, 'H': 1, 'I': 5, 'L': 7, 'K': 3, 'M': 2, 'F': 4, 'P': 3, 'S': 1, 'T': 4, 'W': 0, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 4.48%, 'R': 14.93%, 'N': 1.49%, 'D': 0%, 'C': 8.96%, 'Q': 2.99%, 'E': 2.99%, 'G': 10.45%, 'H': 1.49%, 'I': 7.46%, 'L': 10.45%, 'K': 4.48%, 'M': 2.99%, 'F': 5.97%, 'P': 4.48%, 'S': 1.49%, 'T': 5.97%, 'W': 0%, 'Y': 2.99%, 'V': 5.97%

Missing Amino Acid(s)

D, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, N, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7676.32 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.642	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.866	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.151	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.832	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.036	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.718	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.328, 0.179, 0.209 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.09	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

H.influenzae (Gram-negative), M.catarrhalis (Gram-negative), S.pneumoniae (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Harris RH, Wilk D, Bevins CL, et al. Identification and characterization of a mucosal antimicrobial peptide expressed by the chinchilla (Chinchilla lanigera) airway. J Biol Chem. 2004;279(19):20250-6. Published 2004 May 7. doi:10.1074/jbc.M400499200

PMID: 14996845

5.2 Protein Sequence Databases

UniProt: P83943

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83943

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY128668	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_005373890.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00530000064280

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: ENSGT00530000064280

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download