AMPDB_269 | Ruminococcin-A

PEPTIDE SUMMARY

Ruminococcin-A

1 General Description

AMPDB ID: AMPDB_269

Protein Names: Ruminococcin-A (RumA protein 1 2 3)

Protein Family: Type A lantibiotic family

Gene Name: rumA1; rumA2; rumA3

Source Organism: Ruminococcus gnavus

Protein Length: 47 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRNDVLTLTNPMEEKELEQILGGGNGVLKTISHECNMNTWQFLFTCC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 1, 'N': 5, 'D': 1, 'C': 3, 'Q': 2, 'E': 5, 'G': 4, 'H': 1, 'I': 2, 'L': 6, 'K': 2, 'M': 3, 'F': 2, 'P': 1, 'S': 1, 'T': 5, 'W': 1, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 0%, 'R': 2.13%, 'N': 10.64%, 'D': 2.13%, 'C': 6.38%, 'Q': 4.26%, 'E': 10.64%, 'G': 8.51%, 'H': 2.13%, 'I': 4.26%, 'L': 12.77%, 'K': 4.26%, 'M': 6.38%, 'F': 4.26%, 'P': 2.13%, 'S': 2.13%, 'T': 10.64%, 'W': 2.13%, 'Y': 0%, 'V': 4.26%

Missing Amino Acid(s)

A, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, P, R, S, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5360.17 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	78.723	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	21.706	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.221	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.487	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.412	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.088	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.277, 0.234, 0.298 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.064	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5625	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Dabard J, Bridonneau C, Phillipe C, et al. Ruminococcin A, a new lantibiotic produced by a Ruminococcus gnavus strain isolated from human feces. Appl Environ Microbiol. 2001;67(9):4111-8. Published 2001 Sep. doi:10.1128/AEM.67.9.4111-4118.2001

PMID: 11526013

Citation 2: Marcille F, Gomez A, Joubert P, et al. Distribution of genes encoding the trypsin-dependent lantibiotic ruminococcin A among bacteria isolated from human fecal microbiota. Appl Environ Microbiol. 2002;68(7):3424-31. Published 2002 Jul. doi:10.1128/AEM.68.7.3424-3431.2002

PMID: 12089024

Citation 3: Gomez A, LadirÃ© M, Marcille F, et al. Trypsin mediates growth phase-dependent transcriptional tegulation of genes involved in biosynthesis of ruminococcin A, a lantibiotic produced by a Ruminococcus gnavus strain from a human intestinal microbiota. J Bacteriol. 2002;184(1):18-28. Published 2002 Jan. doi:10.1128/JB.184.1.18-28.2002

PMID: 11741840

5.2 Protein Sequence Databases

UniProt: P83674

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83674

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF320327	GenBank \|\| EMBL
2.	AF320327	GenBank \|\| EMBL
3.	AF320327	GenBank \|\| EMBL
4.	AF439548	GenBank \|\| EMBL
5.	AF439548	GenBank \|\| EMBL
6.	AF439548	GenBank \|\| EMBL
7.	AF439549	GenBank \|\| EMBL
8.	AF439549	GenBank \|\| EMBL
9.	AF439549	GenBank \|\| EMBL
10.	AF439550	GenBank \|\| EMBL
11.	AF439550	GenBank \|\| EMBL
12.	AF439550	GenBank \|\| EMBL
13.	AF439551	GenBank \|\| EMBL
14.	AF439551	GenBank \|\| EMBL
15.	AF439551	GenBank \|\| EMBL
16.	AF439553	GenBank \|\| EMBL
17.	AF439553	GenBank \|\| EMBL
18.	AF439553	GenBank \|\| EMBL
19.	AF439554	GenBank \|\| EMBL
20.	AF439554	GenBank \|\| EMBL
21.	AF439554	GenBank \|\| EMBL
22.	AJ276653	GenBank \|\| EMBL
23.	AJ276653	GenBank \|\| EMBL
24.	AJ276653	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_071144043.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007682

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download