AMPDB_268 | Lysozyme 1

PEPTIDE SUMMARY

Lysozyme 1

1 General Description

AMPDB ID: AMPDB_268

Protein Names: Lysozyme 1 (EC 3.2.1.17) (1;4-beta-N-acetylmuramidase 1) (Invertebrate-type lysozyme 1) (cv-lysozyme 1)

Protein Family: Glycosyl hydrolase 22 family; Type-I lysozyme subfamily

Gene Name: lysoz1 lysoz

Source Organism: Crassostrea virginica (Eastern oyster)

Protein Length: 184 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNGLILFCAVVFATAVCTYGSDAPCLRAGGRCQHDSITCSGRYRTGLCSGGVRRRCCVPSSSNSGSFSTGMVSQQCLRCICNVESGCRPIGCHWDVNSDSCGYFQIKRAYWIDCGSPGGDWQTCANNLACSSRCVQAYMARYHRRSGCSNSCESFARIHNGGPRGCRNSNTEGYWRRVQAQGCN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 19, 'N': 11, 'D': 6, 'C': 22, 'Q': 8, 'E': 3, 'G': 22, 'H': 4, 'I': 7, 'L': 6, 'K': 1, 'M': 3, 'F': 5, 'P': 5, 'S': 22, 'T': 7, 'W': 4, 'Y': 7, 'V': 10

Frequencies of Amino Acids

'A': 6.52%, 'R': 10.33%, 'N': 5.98%, 'D': 3.26%, 'C': 11.96%, 'Q': 4.35%, 'E': 1.63%, 'G': 11.96%, 'H': 2.17%, 'I': 3.8%, 'L': 3.26%, 'K': 0.54%, 'M': 1.63%, 'F': 2.72%, 'P': 2.72%, 'S': 11.96%, 'T': 3.8%, 'W': 2.17%, 'Y': 3.8%, 'V': 5.43%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

C, G, S

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

110

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19985.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	49.837	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	57.59	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.324	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.797	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.458	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.212, 0.326, 0.13 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.087	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	32430, 33805	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Enterococcus (Gram-positive), L.garvieae (Gram-positive), M.luteus (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriolytic enzyme, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Xue QG, Schey KL, Volety AK, et al. Purification and characterization of lysozyme from plasma of the eastern oyster (Crassostrea virginica). Comp Biochem Physiol B Biochem Mol Biol. 2004;139(1):11-25. Published 2004 Sep. doi:10.1016/j.cbpc.2004.05.011

PMID: 15364284

Citation 2: Xue QG, Itoh N, Schey KL, et al. A new lysozyme from the eastern oyster (Crassostrea virginica) indicates adaptive evolution of i-type lysozymes. Cell Mol Life Sci. 2007;64(1):82-95. Published 2007 Jan. doi:10.1007/s00018-006-6386-y

PMID: 17160350

5.2 Protein Sequence Databases

UniProt: P83673

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83673

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB206328	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR008597, IPR023346

PANTHER: PTHR11195

PROSITE: PS51909

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download