AMPDB_267 | Cecropin

PEPTIDE SUMMARY

Cecropin

1 General Description

AMPDB ID: AMPDB_267

Protein Names: Cecropin

Protein Family: Cecropin family

Gene Name: Nil

Source Organism: Glossina morsitans morsitans (Savannah tsetse fly)

Protein Length: 63 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFYKIFVFIALILALSVSQSEAGWLKKIGKKIERVGQNTRDATVKGLEVAQQAANVAATVRG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 3, 'N': 3, 'D': 1, 'C': 0, 'Q': 4, 'E': 3, 'G': 5, 'H': 0, 'I': 5, 'L': 5, 'K': 6, 'M': 1, 'F': 3, 'P': 0, 'S': 3, 'T': 3, 'W': 1, 'Y': 1, 'V': 7

Frequencies of Amino Acids

'A': 14.29%, 'R': 4.76%, 'N': 4.76%, 'D': 1.59%, 'C': 0%, 'Q': 6.35%, 'E': 4.76%, 'G': 7.94%, 'H': 0%, 'I': 7.94%, 'L': 7.94%, 'K': 9.52%, 'M': 1.59%, 'F': 4.76%, 'P': 0%, 'S': 4.76%, 'T': 4.76%, 'W': 1.59%, 'Y': 1.59%, 'V': 11.11%

Missing Amino Acid(s)

C, H, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6850.04 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	108.413	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	30.14	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.211	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.936	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.829	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.001	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.349, 0.175, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.079	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Boulanger N, Brun R, Ehret-Sabatier L, et al. Immunopeptides in the defense reactions of Glossina morsitans to bacterial and Trypanosoma brucei brucei infections. Insect Biochem Mol Biol. 2002;32(4):369-75. Published 2002 Apr. doi:10.1016/s0965-1748(02)00029-2

PMID: 11886771

5.2 Protein Sequence Databases

UniProt: P83403

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83403

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	DQ016433	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 37546.P83403

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download