AMPDB_263 | Cecropin-A

PEPTIDE SUMMARY

Cecropin-A

1 General Description

AMPDB ID: AMPDB_263

Protein Names: Cecropin-A [Cleaved into: Cecropin-A; Cecropin-A amidated isoform]

Protein Family: Cecropin family

Gene Name: CecA CEC1 AGAP000693

Source Organism: Anopheles gambiae (African malaria mosquito)

Protein Length: 58 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFSKIFIFVVLAVLLLCSQTEAGRLKKLGKKIEGAGKRVFKAAEKALPVVAGVKALG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 2, 'N': 1, 'D': 0, 'C': 1, 'Q': 1, 'E': 3, 'G': 6, 'H': 0, 'I': 3, 'L': 8, 'K': 9, 'M': 1, 'F': 4, 'P': 1, 'S': 2, 'T': 1, 'W': 0, 'Y': 0, 'V': 7

Frequencies of Amino Acids

'A': 13.79%, 'R': 3.45%, 'N': 1.72%, 'D': 0%, 'C': 1.72%, 'Q': 1.72%, 'E': 5.17%, 'G': 10.34%, 'H': 0%, 'I': 5.17%, 'L': 13.79%, 'K': 15.52%, 'M': 1.72%, 'F': 6.9%, 'P': 1.72%, 'S': 3.45%, 'T': 1.72%, 'W': 0%, 'Y': 0%, 'V': 12.07%

Missing Amino Acid(s)

D, H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, N, P, Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6158.58 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	122.759	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	20.381	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.61	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.792	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.086	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.939	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.379, 0.172, 0.345 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.069	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.fumigatus, B.cinerea, C.albicans, C.neoformans, F.culmorum, F.oxysporum, N.crassa

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-yeast

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Vizioli J, Bulet P, Charlet M, et al. Cloning and analysis of a cecropin gene from the malaria vector mosquito, Anopheles gambiae. Insect Mol Biol. 2000;9(1):75-84. Published 2000 Feb. doi:10.1046/j.1365-2583.2000.00164.x

PMID: 10672074

Citation 2: Zheng XL, Zheng AL, Zheng AL. Genomic organization and regulation of three cecropin genes in Anopheles gambiae. Insect Mol Biol. 2002;11(6):517-25. Published 2002 Dec. doi:10.1046/j.1365-2583.2002.00360.x

PMID: 12421409

Citation 3: Slotman MA, Parmakelis A, Marshall JC, et al. Patterns of selection in anti-malarial immune genes in malaria vectors: evidence for adaptive evolution in LRIM1 in Anopheles arabiensis. PLoS One. 2007;2(8):e793. Published 2007 Aug 29. doi:10.1371/journal.pone.0000793

PMID: 17726523

Citation 4: Holt RA, Subramanian GM, Halpern A, et al. The genome sequence of the malaria mosquito Anopheles gambiae. Science. 2002;298(5591):129-49. Published 2002 Oct 4. doi:10.1126/science.1076181

PMID: 12364791

5.2 Protein Sequence Databases

UniProt: P82290

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P82290

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF200686	GenBank \|\| EMBL
2.	AF525673	GenBank \|\| EMBL
3.	EU073490	GenBank \|\| EMBL
4.	EU073491	GenBank \|\| EMBL
5.	EU073492	GenBank \|\| EMBL
6.	EU073493	GenBank \|\| EMBL
7.	EU073494	GenBank \|\| EMBL
8.	EU073495	GenBank \|\| EMBL
9.	EU073496	GenBank \|\| EMBL
10.	EU073497	GenBank \|\| EMBL
11.	EU073498	GenBank \|\| EMBL
12.	EU073499	GenBank \|\| EMBL
13.	EU073500	GenBank \|\| EMBL
14.	EU073501	GenBank \|\| EMBL
15.	EU073502	GenBank \|\| EMBL
16.	EU073503	GenBank \|\| EMBL
17.	EU073504	GenBank \|\| EMBL
18.	EU073505	GenBank \|\| EMBL
19.	EU073506	GenBank \|\| EMBL
20.	EU073507	GenBank \|\| EMBL
21.	EU073508	GenBank \|\| EMBL
22.	EU073509	GenBank \|\| EMBL
23.	EU073510	GenBank \|\| EMBL
24.	EU073511	GenBank \|\| EMBL
25.	AAAB01008847	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 7165.AGAP000693-PA

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download