AMPDB_261 | Rhesus theta defensin-1 3 subunit A

PEPTIDE SUMMARY

Rhesus theta defensin-1 3 subunit A

1 General Description

AMPDB ID: AMPDB_261

Protein Names: Rhesus theta defensin-1 3 subunit A (RTD-1 subunit A) (RTD-1a) (Demidefensin-2) (RTD-3)

Protein Family: Alpha-defensin family; Theta subfamily

Gene Name: RTD1A

Source Organism: Macaca mulatta (Rhesus macaque)

Protein Length: 76 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGTDDQGMAHSFTWPENAALPLSESAKGLRCICTRGFCRLL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 15, 'R': 6, 'N': 1, 'D': 3, 'C': 3, 'Q': 6, 'E': 4, 'G': 4, 'H': 2, 'I': 1, 'L': 11, 'K': 1, 'M': 3, 'F': 3, 'P': 3, 'S': 3, 'T': 5, 'W': 1, 'Y': 0, 'V': 1

Frequencies of Amino Acids

'A': 19.74%, 'R': 7.89%, 'N': 1.32%, 'D': 3.95%, 'C': 3.95%, 'Q': 7.89%, 'E': 5.26%, 'G': 5.26%, 'H': 2.63%, 'I': 1.32%, 'L': 14.47%, 'K': 1.32%, 'M': 3.95%, 'F': 3.95%, 'P': 3.95%, 'S': 3.95%, 'T': 6.58%, 'W': 1.32%, 'Y': 0%, 'V': 1.32%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, K, N, V, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8242.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.132	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.411	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.005	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.571	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.349	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.002	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.224, 0.145, 0.434 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.053	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5625	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, C.neoformans, E.coli (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tang YQ, Yuan J, Osapay G, et al. A cyclic antimicrobial peptide produced in primate leukocytes by the ligation of two truncated alpha-defensins. Science. 1999;286(5439):498-502. Published 1999 Oct 15. doi:10.1126/science.286.5439.498

PMID: 10521339

Citation 2: Leonova L, Kokryakov VN, Aleshina G, et al. Circular minidefensins and posttranslational generation of molecular diversity. J Leukoc Biol. 2001;70(3):461-4. Published 2001 Sep. doi:

PMID: 11527997

Citation 3: Tran D, Tran PA, Tang YQ, et al. Homodimeric theta-defensins from rhesus macaque leukocytes: isolation, synthesis, antimicrobial activities, and bacterial binding properties of the cyclic peptides. J Biol Chem. 2002;277(5):3079-84. Published 2002 Feb 1. doi:10.1074/jbc.M109117200

PMID: 11675394

Citation 4: Conibear AC, Rosengren KJ, Harvey PJ, et al. Structural characterization of the cyclic cystine ladder motif of Î¸-defensins. Biochemistry. 2012;51(48):9718-26. Published 2012 Dec 4. doi:10.1021/bi301363a

PMID: 23148585

5.2 Protein Sequence Databases

UniProt: P82270

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P82270

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF191100	GenBank \|\| EMBL
2.	AF191102	GenBank \|\| EMBL
3.	AF184157	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001027989.1

5.5 Protein-Protein Interaction Databases

STRING: 9544.ENSMMUP00000023400

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR016327, IPR002366

PANTHER: PTHR11876

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: mcc:574122

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download