AMPDB_258 | Ribonuclease K3

PEPTIDE SUMMARY

Ribonuclease K3

1 General Description

AMPDB ID: AMPDB_258

Protein Names: Ribonuclease K3 (RNase K3) (EC 3.1.27.-)

Protein Family: Pancreatic ribonuclease family

Gene Name: RNASE6 RNS6

Source Organism: Sus scrofa (Pig)

Protein Length: 153 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MGPDLRCFPLLLLLLGLWWSVRPLCAIPKNLTRAQWFTIQHIQPSPLQCNKAMNSVNNYTWHCKPQNTFLHDSFQDVATACNLPNITCKNGQNNCHQSAKPVSLTQCSFTGGNYPNCRYKDAAQYKFFIVACDPPQKGDPPYPFVPVHLDKII

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 4, 'N': 13, 'D': 7, 'C': 10, 'Q': 11, 'E': 0, 'G': 6, 'H': 5, 'I': 7, 'L': 15, 'K': 9, 'M': 2, 'F': 8, 'P': 16, 'S': 7, 'T': 8, 'W': 4, 'Y': 5, 'V': 7

Frequencies of Amino Acids

'A': 5.88%, 'R': 2.61%, 'N': 8.5%, 'D': 4.58%, 'C': 6.54%, 'Q': 7.19%, 'E': 0%, 'G': 3.92%, 'H': 3.27%, 'I': 4.58%, 'L': 9.8%, 'K': 5.88%, 'M': 1.31%, 'F': 5.23%, 'P': 10.46%, 'S': 4.58%, 'T': 5.23%, 'W': 2.61%, 'Y': 3.27%, 'V': 4.58%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	17350.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.229	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.786	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.272	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.624	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.564	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.829	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.301, 0.275, 0.17 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.111	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	29450, 30075	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), E.faecalis (Gram-positive), E.faecium (Gram-positive), M.luteus (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.saprophyticus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Bai X, Liang Z, Zhao S, et al. The porcine ANG, RNASE1 and RNASE6 genes: molecular cloning, polymorphism detection and the association with haematological parameters. Mol Biol Rep. 2009;36(8):2405-11. Published 2009 Nov. doi:10.1007/s11033-009-9471-0

PMID: 19247805

Citation 2: Iwama M, Sanda A, Ohgi K, et al. Purification and primary structure of a porcine kidney non-secretory ribonuclease. Biosci Biotechnol Biochem. 1993;57(12):2133-8. Published 1993 Dec. doi:10.1271/bbb.57.2133

PMID: 7764367

5.2 Protein Sequence Databases

UniProt: P81649

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P81649

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU814502	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001161128.1

5.5 Protein-Protein Interaction Databases

STRING: 9823.ENSSSCP00000027994

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001427, IPR036816, IPR023411, IPR023412

PANTHER: PTHR11437

PROSITE: PS00127

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ssc:100312981

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download