AMPDB_251 | Hepcidin
PEPTIDE SUMMARY
Hepcidin
1 General Description
AMPDB ID: AMPDB_251
Protein Names: Hepcidin (Liver-expressed antimicrobial peptide 1) (LEAP-1) (Putative liver tumor regressor) (PLTR) [Cleaved into: Hepcidin-25 (Hepc25); Hepcidin-20 (Hepc20)]
Protein Family: Hepcidin family
Gene Name: HAMP HEPC LEAP1 UNQ487 PRO1003
Source Organism: Homo sapiens (Human)
Protein Length: 84 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 8, 'R': 8, 'N': 0, 'D': 2, 'C': 9, 'Q': 7, 'E': 1, 'G': 5, 'H': 2, 'I': 3, 'L': 11, 'K': 2, 'M': 4, 'F': 4, 'P': 4, 'S': 7, 'T': 4, 'W': 2, 'Y': 0, 'V': 1
Frequencies of Amino Acids
'A': 9.52%, 'R': 9.52%, 'N': 0%, 'D': 2.38%, 'C': 10.71%, 'Q': 8.33%, 'E': 1.19%, 'G': 5.95%, 'H': 2.38%, 'I': 3.57%, 'L': 13.1%, 'K': 2.38%, 'M': 4.76%, 'F': 4.76%, 'P': 4.76%, 'S': 8.33%, 'T': 4.76%, 'W': 2.38%, 'Y': 0%, 'V': 1.19%
Missing Amino Acid(s)
N, Y
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
E, V
Hydrophobic Amino Acid(s) Count
42
Hydrophilic Amino Acid(s) Count
42
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 9408.19 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 77.976 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 79.199 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.136 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.517 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.875 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 6.624 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.25, 0.19, 0.286 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.071 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 11000, 11500 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), N.cinerea (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.epidermidis (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Park CH, Valore EV, Waring AJ, et al. Hepcidin, a urinary antimicrobial peptide synthesized in the liver. J Biol Chem. 2001;276(11):7806-10. Published 2001 Mar 16. doi:10.1074/jbc.M008922200
PMID: 11113131
Citation 2: Krause A, Neitz S, Mägert HJ, et al. LEAP-1, a novel highly disulfide-bonded human peptide, exhibits antimicrobial activity. FEBS Lett. 2000;480(2-3):147-50. Published 2000 Sep 1. doi:10.1016/s0014-5793(00)01920-7
PMID: 11034317
Citation 3: Clark HF, Gurney AL, Abaya E, et al. The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003;13(10):2265-70. Published 2003 Oct. doi:10.1101/gr.1293003
PMID: 12975309
Citation 4: Grimwood J, Gordon LA, Olsen A, et al. The DNA sequence and biology of human chromosome 19. Nature. 2004;428(6982):529-35. Published 2004 Apr 1. doi:10.1038/nature02399
PMID: 15057824
Citation 5: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504
PMID: 15489334
Citation 6: Klüver E, Schulz A, Forssmann WG, et al. Chemical synthesis of beta-defensins and LEAP-1/hepcidin. J Pept Res. 2002;59(6):241-8. Published 2002 Jun. doi:10.1034/j.1399-3011.2002.00980.x
PMID: 12010514
Citation 7: Nemeth E, Rivera S, Gabayan V, et al. IL-6 mediates hypoferremia of inflammation by inducing the synthesis of the iron regulatory hormone hepcidin. J Clin Invest. 2004;113(9):1271-6. Published 2004 May. doi:10.1172/JCI20945
PMID: 15124018
Citation 8: Ganz T, Nemeth E, Nemeth E. Hepcidin and iron homeostasis. Biochim Biophys Acta. 2012;1823(9):1434-43. Published 2012 Sep. doi:10.1016/j.bbamcr.2012.01.014
PMID: 22306005
Citation 9: Qiao B, Sugianto P, Fung E, et al. Hepcidin-induced endocytosis of ferroportin is dependent on ferroportin ubiquitination. Cell Metab. 2012;15(6):918-24. Published 2012 Jun 6. doi:10.1016/j.cmet.2012.03.018
PMID: 22682227
Citation 10: Aschemeyer S, Qiao B, Stefanova D, et al. Structure-function analysis of ferroportin defines the binding site and an alternative mechanism of action of hepcidin. Blood. 2018;131(8):899-910. Published 2018 Feb 22. doi:10.1182/blood-2017-05-786590
PMID: 29237594
Citation 11: Hunter HN, Fulton DB, Ganz T, et al. The solution structure of human hepcidin, a peptide hormone with antimicrobial activity that is involved in iron uptake and hereditary hemochromatosis. J Biol Chem. 2002;277(40):37597-603. Published 2002 Oct 4. doi:10.1074/jbc.M205305200
PMID: 12138110
Citation 12: Jordan JB, Poppe L, Haniu M, et al. Hepcidin revisited, disulfide connectivity, dynamics, and structure. J Biol Chem. 2009;284(36):24155-67. Published 2009 Sep 4. doi:10.1074/jbc.M109.017764
PMID: 19553669
Citation 13: Billesbølle CB, Azumaya CM, Kretsch RC, et al. Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms. Nature. 2020;586(7831):807-811. Published 2020 Oct. doi:10.1038/s41586-020-2668-z
PMID: 32814342
Citation 14: Biasiotto G, Belloli S, Ruggeri G, et al. Identification of new mutations of the HFE, hepcidin, and transferrin receptor 2 genes by denaturing HPLC analysis of individuals with biochemical indications of iron overload. Clin Chem. 2003;49(12):1981-8. Published 2003 Dec. doi:10.1373/clinchem.2003.023440
PMID: 14633868
Citation 15: Merryweather-Clarke AT, Cadet E, Bomford A, et al. Digenic inheritance of mutations in HAMP and HFE results in different types of haemochromatosis. Hum Mol Genet. 2003;12(17):2241-7. Published 2003 Sep 1. doi:10.1093/hmg/ddg225
PMID: 12915468
Citation 16: Roetto A, Daraio F, Porporato P, et al. Screening hepcidin for mutations in juvenile hemochromatosis: identification of a new mutation (C70R). Blood. 2004;103(6):2407-9. Published 2004 Mar 15. doi:10.1182/blood-2003-10-3390
PMID: 14630809
Citation 17: Jacolot S, Le Gac G, Scotet V, et al. HAMP as a modifier gene that increases the phenotypic expression of the HFE pC282Y homozygous genotype. Blood. 2004;103(7):2835-40. Published 2004 Apr 1. doi:10.1182/blood-2003-10-3366
PMID: 14670915
Citation 18: Delatycki MB, Allen KJ, Gow P, et al. A homozygous HAMP mutation in a multiply consanguineous family with pseudo-dominant juvenile hemochromatosis. Clin Genet. 2004;65(5):378-83. Published 2004 May. doi:10.1111/j.0009-9163.2004.00254.x
PMID: 15099344
5.2 Protein Sequence Databases
UniProt: P81172
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: P81172
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF309489 GenBank || EMBL
2. AJ277280 GenBank || EMBL
3. AF131292 GenBank || EMBL
4. AY358669 GenBank || EMBL
5. DQ496109 GenBank || EMBL
6. AD000684 GenBank || EMBL
7. BC020612 GenBank || EMBL
CCDS: CCDS12454.1
RefSeq: NP_066998.1
5.5 Protein-Protein Interaction Databases
STRING: 9606.ENSP00000471894
IntAct: P81172
MINT: Not found
DIP: Not found
BioGRID: 121776
5.6 Ligand Databases
BindingDB: Not found
DrugBank: DB13257
ChEMBL: CHEMBL3989381
5.7 Family & Domain Databases
InterPro: IPR010500
PANTHER: PTHR16877
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: ENSGT00390000003154
KEGG: hsa:57817
5.9 Phylogenomic Databases
GeneTree: ENSGT00390000003154
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: P81172




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India